SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011617 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011617
Domain Number 1 Region: 414-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.56e-54
Family Eukaryotic proteases 0.00061
Further Details:      
 
Domain Number 2 Region: 123-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-33
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 3 Region: 280-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000973
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 234-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011617   Gene: ENSMPUG00000011711   Transcript: ENSMPUT00000011809
Sequence length 720
Comment pep:known scaffold:MusPutFur1.0:GL896949.1:9280793:9351923:-1 gene:ENSMPUG00000011711 transcript:ENSMPUT00000011809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGCWTQLGLTFLQLLLISSLPREYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKE
VVGYTIPCCRNEENECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGIYCAECRAGW
YGGDCMRCGQVLRASKGQILLESYPLNAHCEWTIHAKPGFIIQLRFVMLSLEFDYMCQYD
YVEVRDGDSSSSQIIKRFCGNERPAPIRSTDSSLHILFHSDGSKNFDGFHAIFEEITACS
SSPCFHDGTCLLDKTGSYKCACLAGYTGQRCENLLEESNCSDPGGPVNGYQKVTGGPGLI
NGRYAKVGTVVSFFCNNSYVLSGNEKRTCQQDGEWSGKQPICIKACREPKISDLVRRRVL
PMQVQSRQTPLHQLYSASFSKQKLQGAPTKKPALPFGDLPPGFQHLHTQLQYECISPFYR
RLGSSRRTCLKTGKWSGRAPSCVPICGKTENVTASKIPGLRWPWQAAIYRRASGVHGGSL
HKDTWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADLKVVLGKFYRDDDRDEKTIQN
LRISAVILHPNYDPILLDTDIAILKLLDKARVSTRVQPICLAAPRDLSASFQETRITVAG
WNVLADARSPGFKNDTLRSGGVRVVDPLLCEEQHEEHGIPVSVTDNMFCATRDPAAPSDI
CTAETGGIAAVAFPGRASPEPRWHLVGLVSWSYDRDCGHSLYTAFSKVLPFKDWIERNMK
Download sequence
Identical sequences M3YJW0
ENSMPUP00000011617 XP_004756043.1.14098 ENSMPUP00000011617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]