SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011751 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011751
Domain Number 1 Region: 144-357
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.05e-61
Family DBL homology domain (DH-domain) 0.0000000651
Further Details:      
 
Domain Number 2 Region: 342-498
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-48
Family Pleckstrin-homology domain (PH domain) 0.00000271
Further Details:      
 
Domain Number 3 Region: 50-168
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-22
Family SH3-domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011751   Gene: ENSMPUG00000011844   Transcript: ENSMPUT00000011944
Sequence length 558
Comment pep:novel scaffold:MusPutFur1.0:GL897154.1:388627:637987:-1 gene:ENSMPUG00000011844 transcript:ENSMPUT00000011944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWPEYIPDTAIPDGVLDTALRADEVESEEDLFEDMHSSSHHYSHPGGGGEQLAINELIS
DGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPATFVRLRV
NQDEPADEEALRARDGEAEDGGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYIR
QCRKRADMFSEEQLRTIFGNIEDIYQCQKAFVKALEQRFNRERPHLSELGACFLEHQADF
QIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYPL
QLAELLKYTPPQHRDFKDVEAALHAMRNVAQLINERKRRLENIDKIAQWQSSIEDWEGED
ILVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRVDMDGQ
EVVDLEDGKDRDLHVSVKNAFRLLCGTTGESHLLCARKSEQKQRWLKAFAKEREQVRLDQ
ETGFSITELQRKQAMLNASKQQATGKPKALSRPYYLARQKHPVLPTSLPQQQVLVLAEPK
RKPSTFWHSISRLAPFRK
Download sequence
Identical sequences M3YK94
ENSMPUP00000011751 ENSMPUP00000011751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]