SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011799 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000011799
Domain Number - Region: 27-86
Classification Level Classification E-value
Superfamily HSC20 (HSCB), C-terminal oligomerisation domain 0.0811
Family HSC20 (HSCB), C-terminal oligomerisation domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011799   Gene: ENSMPUG00000011889   Transcript: ENSMPUT00000011992
Sequence length 199
Comment pep:novel scaffold:MusPutFur1.0:GL896922.1:1491213:1633815:-1 gene:ENSMPUG00000011889 transcript:ENSMPUT00000011992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGALWALRRRGRAWPTPPAPAVLQLKQQRDKLKQYQKRITQQLEREREIARQLLRDGKKE
RAKLLLKKKRYREQLLDKTENQITSLETMVQSIEFTQIEMKVVEGLQIGNECLKKMHQVM
SIEEVERILEETQEAVEYQRQIDELLARSFTQEDEEAILEELNAITQEQIELPEVPSEPL
PEKKPEKVPREAKPRQVEL
Download sequence
Identical sequences M3YKE2
ENSMPUP00000011799 ENSMPUP00000011799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]