SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011844 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011844
Domain Number 1 Region: 395-658
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-81
Family Protein kinases, catalytic subunit 0.0000132
Further Details:      
 
Domain Number 2 Region: 70-148
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.27e-33
Family PB1 domain 0.00000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011844   Gene: ENSMPUG00000011935   Transcript: ENSMPUT00000012038
Sequence length 660
Comment pep:novel scaffold:MusPutFur1.0:GL897154.1:1096783:1173460:1 gene:ENSMPUG00000011935 transcript:ENSMPUT00000012038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQQALNSIMQDLAVLHKASRPALSLQETRKTKASSPKKQEYPGLREGLLKCLLVYTYK
ICLGCSTQKNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIP
LTTQDDLDKAVELLDRSIHMKSLKILLVINGSAQLILAPQNQVGRIINTISGLYLVGERI
LFEAPKERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQC
SMLDPLSLSSPENSGSGSCPSLDSPLDGVNFKSQAFASMHQISVKKEVSIDYDNPIFEKF
GKGGTYPRRYHVSYHHQDYNDGRKTFPRARRTQGTSFRSPVSFSPTDHSLSTSSGSSIFT
PEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDVDT
GRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFME
YMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVK
LGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEK
PPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFIEAKLRPSADELLRHMFVHY
Download sequence
Identical sequences M3YKI7
ENSMPUP00000011844 ENSMPUP00000011844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]