SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011849 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011849
Domain Number 1 Region: 4869-5084
Classification Level Classification E-value
Superfamily GFP-like 2.72e-64
Family Domain G2 of nidogen-1 0.00082
Further Details:      
 
Domain Number 2 Region: 2474-2573
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-24
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 3240-3341
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-24
Family I set domains 0.0048
Further Details:      
 
Domain Number 4 Region: 3626-3718
Classification Level Classification E-value
Superfamily Immunoglobulin 5.97e-24
Family I set domains 0.0098
Further Details:      
 
Domain Number 5 Region: 2959-3058
Classification Level Classification E-value
Superfamily Immunoglobulin 8.17e-24
Family I set domains 0.0054
Further Details:      
 
Domain Number 6 Region: 4073-4170
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-23
Family I set domains 0.029
Further Details:      
 
Domain Number 7 Region: 2582-2669
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-23
Family I set domains 0.0098
Further Details:      
 
Domain Number 8 Region: 2393-2481
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 2879-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-23
Family I set domains 0.0057
Further Details:      
 
Domain Number 10 Region: 2680-2768
Classification Level Classification E-value
Superfamily Immunoglobulin 9.34e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 1166-1263
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 4346-4445
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-22
Family I set domains 0.0076
Further Details:      
 
Domain Number 13 Region: 3707-3805
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 14 Region: 603-700
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 15 Region: 789-885
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 16 Region: 3145-3246
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-22
Family I set domains 0.0045
Further Details:      
 
Domain Number 17 Region: 1086-1177
Classification Level Classification E-value
Superfamily Immunoglobulin 3.21e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 18 Region: 3799-3898
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-22
Family I set domains 0.0065
Further Details:      
 
Domain Number 19 Region: 2298-2387
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-22
Family I set domains 0.025
Further Details:      
 
Domain Number 20 Region: 3901-3993
Classification Level Classification E-value
Superfamily Immunoglobulin 5.53e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 21 Region: 4429-4526
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 22 Region: 3522-3621
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 23 Region: 3052-3152
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-21
Family I set domains 0.0041
Further Details:      
 
Domain Number 24 Region: 1822-1920
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-21
Family I set domains 0.0082
Further Details:      
 
Domain Number 25 Region: 889-983
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 26 Region: 2789-2871
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 27 Region: 42-218
Classification Level Classification E-value
Superfamily vWA-like 1.9e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 28 Region: 4163-4261
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 29 Region: 3442-3528
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-21
Family I set domains 0.0089
Further Details:      
 
Domain Number 30 Region: 3985-4083
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-21
Family I set domains 0.034
Further Details:      
 
Domain Number 31 Region: 1366-1455
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 32 Region: 2102-2198
Classification Level Classification E-value
Superfamily Immunoglobulin 5.61e-21
Family I set domains 0.0072
Further Details:      
 
Domain Number 33 Region: 1634-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 5.92e-21
Family I set domains 0.0042
Further Details:      
 
Domain Number 34 Region: 1929-2014
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 35 Region: 518-618
Classification Level Classification E-value
Superfamily Immunoglobulin 7.99e-21
Family I set domains 0.073
Further Details:      
 
Domain Number 36 Region: 1728-1828
Classification Level Classification E-value
Superfamily Immunoglobulin 8.14e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 37 Region: 4250-4347
Classification Level Classification E-value
Superfamily Immunoglobulin 9.76e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 38 Region: 1448-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 39 Region: 3349-3434
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 40 Region: 2008-2107
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-20
Family I set domains 0.0079
Further Details:      
 
Domain Number 41 Region: 1542-1641
Classification Level Classification E-value
Superfamily Immunoglobulin 2.24e-19
Family I set domains 0.0035
Further Details:      
 
Domain Number 42 Region: 2191-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 3.36e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 43 Region: 1279-1361
Classification Level Classification E-value
Superfamily Immunoglobulin 7.59e-19
Family I set domains 0.0041
Further Details:      
 
Domain Number 44 Region: 701-799
Classification Level Classification E-value
Superfamily Immunoglobulin 4.23e-18
Family I set domains 0.028
Further Details:      
 
Domain Number 45 Region: 981-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 7.46e-18
Family I set domains 0.0089
Further Details:      
 
Domain Number 46 Region: 5090-5235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.41e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 47 Region: 4638-4696
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.71e-16
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 48 Region: 4582-4639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 6.02e-16
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 49 Region: 4696-4753
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 50 Region: 4810-4867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 51 Region: 4527-4577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000824
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 52 Region: 4752-4810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 53 Region: 5286-5409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 54 Region: 445-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000922
Family I set domains 0.05
Further Details:      
 
Domain Number 55 Region: 5227-5282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011849   Gene: ENSMPUG00000011941   Transcript: ENSMPUT00000012044
Sequence length 5517
Comment pep:known scaffold:MusPutFur1.0:GL897029.1:5651079:6145951:1 gene:ENSMPUG00000011941 transcript:ENSMPUT00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWDVVHTVFLFALLYSSQAQDASPQPDPGAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRGH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQSSKVHLLSTDHLEQAVNTWKIPF
DPSLKEVTVSLSGPSPGIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK
ISSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISIPARVD
RLELLSTSGSSLKTIPVKYYPDRKPYGVWNISDFIPPNEAFFLKITGYDKDDYLFQRVSS
VSFSSIIPDAPRVTMPKKTPGYYLQPGQIPCSVESLLPFTLSFVRNGVTLGVDQYLKESA
SVNWEIEKVTLSDEGAYDCIAVSSAGTGRAQTFFDVSEPPPVIQVPDNVTVPPGERAVLT
CLVLSAVDYNLTWQRNDRDARQADPARMRILANLSLELRSVKFSDAGEYLCVVSNEGGSS
AASVFLTVQEPPKVTVMPRNQSFTGGSEVSIRCSATGYPKPKLTWTINDMFIMGSHRYRM
TSEGNLFIKNAVPKDAGIYGCLASNAAGRDKQTSTLRYIEAPKLIVVQSELLVALGDTTV
MECKTSGIPPPQVKWFKGDLELRPSTFLIIDPLLGLLKIQETQDLDAGDYTCVAVNDAGR
AAGKITLDVGSPPVFIQEPADVSVEIGSNVTLPCYVQGYPEPKIKWQRSDNMPIFSRPFS
VSSISQLRTGALFISNIWANDKGTYICEAENQFGKVQSQTTVTVTGLVAPLIGISPSVTS
VIEGQQLTLPCALLAGNPIPERRWIKNSAMLVQNPYITVRSDGSLHIERVRLQDGGKYTC
VASNVAGTINKTTTVDVHVLPTIQHGQQVLSTIEGIPVTLPCKASGIPKPSIIWSKKGEL
ISTSSAKFSAGADGSLYVSSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRG
LSQDKPVEISVLAGEEVTLPCEVKSLPPPVITWAKETQLISPFSPRHTFLPSGSMKIIET
RVSDSGMYLCVATNIAGNVTQSVKLNVHVPPKIQRGPKLMKVQAGQRVDIPCNAQGMPLP
AITWLKDGSAALVDGVRLVSNSDGTLSIDPALLSDAGVYTCVATNMAGSDETEITLHVQE
PPTLEDLEPPYNTPFQERVASERIAFPCPAKGTPKPTIKWIWNGRELTGREPGISILEDG
TLLVIASVTPSDNGEYICVAVNEAGTTEKKYNLKVHVAPVIKDKEQITNVSVLVNQLTNL
FCEVEGTPSPIIMWYKDDVQVTESSTIQIVNNGKILKLFRVAPEDAGSYSCKAVNVAGTS
QKYFNIEVLVPPTIIGAGSPNEVSVVLNRDITLECKVKGTPFPVIHWFKDGKPLFLEDPN
IELLDRGQVLRLKNARRGDKGRYQCAASSGAGKQAKDIKLTVYIPPSIKGGNVTTEISAL
INSIIKLECETRGLPMPAIAWHRDGQPVIPSSQALYIDKGQFLHIPRAQVSDSATYTCHA
TNVAGTAEKSFHVDVYVPPMIEGDLAVPLNKQVVIAHSLTLECKATGNPPPVLTWLKDGV
PVKPSDNIRIEAGGKKLEIRSALEADRGQYVCVATSVAGEKEIKYEVDVLVPPAIEGGDE
TSYFIVMINNLLELDCQVTGSPTPTIMWLKDGQIIDERDGFKILLNGRKLVITQAQVSDT
GLYRCVATNIAGDHRKEFEVTIHVPPTIKSSGLSERAIVKYKPITLQCIANGIPNPSITW
LKDGQPINTAQGNLKIQSSGRVLQIAKALMEDAGRYTCVATNAAGETQQHLQLHVHEPPS
LEDAGKMLNETVVLNNPIQLECKAAGNPLPAITWYKNNRPLSGSSGVTFLNRGQIIDIES
AQISDAGIYKCVAINSAGATELFYSLQVHVPPSISGSNNMVAVVVNNLVRLECEARGTPA
PSLTWLKDGSPVSSFANGLQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRV
YVPPNIMGEEQNISVLISQAVELLCQSDAIPPPTLTWLKDGRPLLKKPGLSISENGSVLK
IEEAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIYGSDERAQLTVIEGNLISLLCES
SGIPPPNLVWKKKGLPVLTDSAGRVRTLSGGRQLQISVAEKSDAGLYTCVASNVAGTAKK
DYDLQVYIRPTISNSGSHPTEITVTRGKGISLECEVQGIPQPKVTWMKDGRPLTKGRGME
ILDEGRILQLKNIHVSDTGRYVCVAVNVAGMTDRKYDLSVHTPPSIIGNHGIPDNISVVE
KNSVSLTCEASGIPLPSITWLKDGWPVSLSSSVRILSGGRTLRLMQTRVEDAGQYICVVR
NAAGEERKIFGLSVLVPPRIVGENILEHVKVKEKQSITLTCEVTGNPMPEITWHKDGQLL
LKDDTHHIMSGGRFLKITNAQVSHTGRYACLASNTAGDKSKSFSLNVLVSPTIAGVDSDG
GPEDVTVILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQEDN
AGRYSCIATNEAGEMIKHYEVKVYIPPIINKGDILGPGLSPKEVKIKVNNTLTLECEAYA
IPSASFSWYKDGQPLKSDDHVNIAASGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDV
NIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPISLYCETNAAPPPTLTWYKDGRPLTS
SDRVLILPGGRVLQIPRAKVEDAGRYMCVAVNEAGEDSLQYDVRVLLPPVIKGANSDLPE
EVTVLVNKSTLMECLSSGNPAPRSSWQKDGQPLQEDGHHKFLSNGRILQILNTQITDIGR
YVCVAENTAGSAKKYFNLNVHVPPSVIGPNPENLTVVVNNFISLTCEVSGFPPPDLSWLK
NEQPIKLNTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKVFLTVYVPPSIKD
HGSESLSVVTVREGTSVSLECESNAVPPPVITWYKNGQITESTHWEILADGQMLHIQKAE
VSDTGQYVCRAINVAGRDDKNFHLNVYVPPTIEGPENEGVVETISNPVTLTCDATGIPPP
TIAWLKNHKPIENSNSLEVHILSGGSKLQIARSQHSDSGNYTCIASNMEGKAQKNYILSI
QVPPSIAGAEIPSEVSVLQGENVELTCNANGIPTPLIQWLKDGKPLNKSETERIRVTADG
STLNIYGALPSNVGKYTCVATNPAGEEDRIFNLNVYVPPAIRGNKEEAEKLMALVDTSIN
IECRATGTPPPQINWLKNGLPLPLSSHIRLLSGGQVIRIVRAQVSDVAMYTCVASNRAGV
DNKHYSLRVLVPPNLDNAMGTEEITIVKGSSTSMTCFTDGTPTPRMSWLRDGQPLNPNSR
LKISTQGMVLQLDKAETEDSGKYICIASNEAGEVNKHFILKVLEPPHINGSEEPVEISVI
VNNPLEFTCFASGIPTPKITWMKDGRPLPQTDQVQTLGGGAVLRISSAQVEDTGRYTCLA
SSTAGDDDKEYLVRVHVPPNIAGTDESQDFTVLRNRQVTLECKSDAVPPPVITWLKNGER
LQATPRVRILSGGRYLQINNADLSDTANYTCVASNIAGKTTREFILTVNVPPNIKSGPQS
LVIHLNTSTVLECLAEGVPAPRITWRKDGAVLTASHARYSILENGFLHIQSAHVADTGRY
LCMATNAAGTDRRRIDLQVHVPPSIALGPTNITVTVNVQTTLACEAAGIPKPSIRWRKNG
HLLNVDQNQNSYRLLSSGSLVIISPSVDDTATYECTVTNDAGEDKRTVDLTVQVPPSIAD
EPTDFVVTKHAPTVITCTASGVPIPSIHWTKNGIRLHPRGDGYRILSSGAIEIFATQLNH
AGKYTCVARNAAGSAHRHVTLYVQEPPVIQPQPSELDVIVNNPILLPCEATGTPSPFITW
QKEGINVVTAGKSHAVLPGGGLQISRAAREDAGTYMCVAQNPAGTALGKIKLNVQVPPVI
SPHPKEYITAVDKPISLPCEADGLPPPDITWHKDGGVVVESVRQRILSSGALQIAFAQPD
DAGQYTCMAANAAGSSSTSVKLTVHVPPRIRSTEIHYTVNENSQAILPCMADGIPTPAIN
WKKGNVLLANLLGKYTIEPYGELILENVVPEDSGTYTCVANNAAGEDTHMVSLTVHVLPT
FTELPGDVSLSKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSKE
DSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAVLNCEVKGDPAPTI
QWSRKGVDIEINHRIRQLVNGSLAIYGTVNEDAGDYTCIATNDAGVVERSMSLTLQSPPI
ITLEPVETIINAGDKVILNCQATGEPHPTITWSRQGQSIPWDDRVNVLSNNSLHIAAAQK
EDTSEYECVARNLMGSVLVRVPVTVQVHGGYSQWSTWRACSVTCGKGIQKRSRLCNNPFP
ANGGKPCQGSDSEMRNCQRKLCPVDGSWSEWSPWEECTRSCGRGNRTRTRTCNNPSAQYG
GRPCEGNAVEIIMCNIRPCPVHGAWSTWQPWSACSESCGKGTQIRTRLCNNPPPSFDGSY
CDGAETQMQVCNERHCPVDGKWAPWTSWSACTVSCGGGARQRTRECSDPVPQYGGSRCEG
SDVQSDFCNNDPCPTHGNWSPWSGWGMCSRTCNGGQMRRYRTCDNPHPSNGGRACGGPDS
QIQRCNTDMCPVDGSWGDWHSWGQCSASCGGGEKTRKRLCNNPVPSKSGRPCPGDATQVS
RCNMQACPGGPQRARGSVIGNINDVEFGIAFLNATVIDSPTSDTRIIQAKITNVPRSLGP
AMRKIVSILNPIYWTTAKEIGEAVNGFTLTNAVFKRETQVEFATGEILRMTHVARGLDSD
GALLLDIVVSGHVLQLQSPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGVSVPYTWNH
TVFYDEAQGRMPFLVETLHASSVESDYSQLEETLGFKIHASISKGDRSNQCPSGFALDSV
GPFCADEDECAAGSPCSQICHNTVGTYYCSCLKGLTIAADGRTCQDVDECALGGHICHAG
QDCDNTIGSYRCVVRCGIGFRRTSDGLSCQDINECQESSPCHHRCFNAIGSFHCGCEPGY
QLKGRKCIDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGTH
QCRYNQICENTRGSYRCVCPRGFRSQGVGRPCMDIDECENRDICQHECKNTFGSYQCICP
PGYQLMLNGKTCQDVDECLEQSVRCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLK
NCPPNDLECALSPYALEYKLISLPFGIAANQDLIRLVAYTQDGVMHPRTTFLMVDEEQTA
PFALRDENLKGVVYTTRPLREPETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences M3YKJ2
ENSMPUP00000011849 XP_004768022.1.14098 ENSMPUP00000011849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]