SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011968 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011968
Domain Number 1 Region: 183-393
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.15e-56
Family Fibrinogen C-terminal domain-like 0.00000813
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011968   Gene: ENSMPUG00000012060   Transcript: ENSMPUT00000012163
Sequence length 393
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:1460660:1466835:1 gene:ENSMPUG00000012060 transcript:ENSMPUT00000012163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSRVARPLRPAGCLLLLLCIKTLATQAADTCPEVKVVGLEGSDKLSILRGCPGLPGAA
GPKGDAGVNGARGAPGSPGVPGKAGPPGPKGNNGMKGHGPSRDPGVRPRRKERGAQTEGQ
GDGDMGTWGHREERERDRGGTRRQTEGQHSSGRISEEPQPPCRGSLPPVSAPGDRGDTGV
CGEKAPRTCKDLLTRGHSLTGWHTVYLPGCRPLSVLCDMDTDGGGWTVSVGGQGTAQWCV
GTAGSAWGSHRAARPLAGRTLSLSAPGTSELRVDLVDFEGNRQFAKYNSFRMAGEAEKYR
LLLGAFAGGSAGDSLTYHNNHPFSTKDQDNDSSPENCAERYQGAWWYDNCHLSNLNGLYL
GGAHESYANGINWKSGKGYNYSYKVSVMMVRPV
Download sequence
Identical sequences M3YKW1
ENSMPUP00000011968 ENSMPUP00000011968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]