SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012023 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012023
Domain Number 1 Region: 177-387
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.35e-56
Family Fibrinogen C-terminal domain-like 0.00000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012023   Gene: ENSMPUG00000012118   Transcript: ENSMPUT00000012221
Sequence length 387
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:1479222:1485760:-1 gene:ENSMPUG00000012118 transcript:ENSMPUT00000012221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSGAAAATLVALLCTGAWAAADTCPEVKVVGLEGSDKLSILRGCPGLPGAAGPKGDAG
VNGARGAPGSPGVPGKAGPPGPKGNNGMKGHGPSRDPGVRPRRKTDCKRQKRQLTNSKPS
PVLHAQVKRAGLGHRAECPTPPRSPPAEDQGGSAGRPGVRGLRWGGPGRDGQLPGLSPAP
RTCKDLLTRGHSLTGWHTVYLPGCRPLSVLCDMDTDGGGWTVSVGGQGTAQWCVGTAGSA
WGSHRAARPLAGRTLSLSAPGTSELRVDLVDFEGNRQFAKYNSFRMAGEAEKYRLLLGAF
AGGSAGDSLTYHNNHPFSTKDQDNDSSPETCAERYQGAWWYDKCHLANLNGLYLPGSHET
FANGINWKSGKGYNYSYKVSVMMVRPV
Download sequence
Identical sequences M3YL16
ENSMPUP00000012023 ENSMPUP00000012023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]