SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012122 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012122
Domain Number 1 Region: 853-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 623-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000955
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 3 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000114
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 744-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 
Domain Number 5 Region: 798-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 566-626
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000249
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012122
Domain Number - Region: 691-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000124
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012122   Gene: ENSMPUG00000012219   Transcript: ENSMPUT00000012322
Sequence length 955
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:2344221:2375970:-1 gene:ENSMPUG00000012219 transcript:ENSMPUT00000012322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGRQPSLWVWSLLAGALLAGGMAPTGATDNSPTSNSLEGGTDATAYWWGEWTKWTACS
RSCGAGVTSQERHCLQQRRTSVLGAGNRTCTGTSKRYQLCRVQDCPPDGRSFREEQCISF
NSRVYDGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGSYFFNGNFKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHARRLQPVYYSFSEPASESAESQELD
GAALLGFLRHNGSFYGQTSSERLGLDNRLFGHLGPGIELGLSKGQETNEVCEQAGGGSCE
GPPRGKGFRDGNATGTALAGDKDDQEVDARLPSQRLLSANVISDQLLGAGSDSRELPFNE
TGNSIFAPGGPRSSAAESLYADYEENGGGGAYLLNGSYLELHSDGMTNVSSEAPFPNASA
SLPTLAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCATGVLSTYAMCVRYDG
IEVDDSFCDALTRPEPVQEFCAGRECQPRWETSSWSECSRTCGEGYQVRIVRCWKMLSPG
FDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECAAKCGEQSVVTRDIRCSED
EKLCDPDTRPVGEKDCTGPPCDRQWTVSDWGPCSGSCGHGRMIRHVYCKTGDGRVVPESQ
CQTETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPE
CGLAKKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKP
VGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHT
Download sequence
Identical sequences M3YLB5
ENSMPUP00000012122 ENSMPUP00000012122 XP_004757067.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]