SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012207 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012207
Domain Number 1 Region: 218-423
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.86e-41
Family Reprolysin-like 0.0024
Further Details:      
 
Domain Number 2 Region: 521-577
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000772
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 1259-1323
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000732
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 877-942
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 5 Region: 1374-1460
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000419
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Domain Number 6 Region: 1212-1265
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 7 Region: 1141-1205
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000445
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 8 Region: 1481-1589
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000105
Family Spermadhesin, CUB domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012207
Domain Number - Region: 1035-1084
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00641
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012207   Gene: ENSMPUG00000012303   Transcript: ENSMPUT00000012407
Sequence length 1603
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:2429628:2458337:-1 gene:ENSMPUG00000012303 transcript:ENSMPUT00000012407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREPHPWQRGLGAILTSALFLLGCWGLSDFQQQFLQALEPEEVTSYFGPEATLKVPPFRV
APLSCVCEDRPRGFPCMTPRCSLHAWGRRIAVSFPPERSLLSGSFTSERVLNASLRLLRR
LTHLCFTGGRPLLPPGARARVTYCSGGLEGDILVGADRFYVQPVRRQHQELVLPWVRAQP
HLIHRPVPKVPTVPEAPEVIQGHLPSPRVRRRAAGSVLHLELLVAVGPDVYQAHQEDTER
YVLTNLNMGSELLRDPSLGAQFRVHLVKMVILTQAEDAPSITGNITASLLSVCEWSRTVN
PEDDADPGHADLVLYITRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGVTI
AHEIAHSLGVEHDGAPGSGCGPSGHVMASGDAAPAPGDLSWSACSRRQVLQLLSAGRAHC
LLDLPGPQTGTAGGPPPAQPGLLYGADEQCRVAFGAKAVACTFTREHLDMCQALSCHTDP
LDQSSCSRLLVPLLDGTECGMQKWCSKGHCRSLAELSPVGVVHGHWSSWGPPSPCSRSCG
GGVVTRRRHCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMAEQCSQTDGKPLYLS
PGNASFYRWGPAEQYSQGDALCRHMCRAIGETFMVRRGDRFLDGTRCVPSGRQEDGTLSL
CVAGSCRTFGCDGAMDSPQVRDVCQVCGGDNSTCQQRNGSFTGGRAREYVTFLTVTRNLT
SVHITNRRPLFTHLAVRIRGRYVVAGTSSISPSTTYPSLLEDSRVGYRVALTEDRLPLLE
EIHIWGPSQDDVEIQVYRRYGEEYGDLARPDITFTYFQPKRPQAWAWAAMRGSCSVSCGA
GLRWVTYGCLDQARNEWAEAARCEGSQQPAAWSESCAPRPCPPYWAAGDFGACSVSCGGG
LRARAVRCVEAQGTLLRPLPPARCRVLAPEPAVVEACNLQACPVRQEGSDACSPACGADP
ALWNRTCVHRAEGLATAGPCPTDEKLPTQEPCVATACSPEPSDPDPRPLEEEATSPPGGA
GVGAHAAHMWTPLAGPCSASCGRGLRELRFVCMDSVLGTPVQEELCDLGSKPGSRQEACR
AAPCPAWWETRASAPCPVTCGRGWVPLAIRCVRLDQGHPVPLPPSECWRVPRPSPVQDCS
PKPCPARWRYKLAACSVSCGGGFAQRLLYCARAHGEHEDEEVLPDTQCQGLPRPEQREAC
SPEPCPARWKILSLGPCSASCGLGTATRSVACVQLSQGQDMEVEGAACAAQVRPQASVPC
VITDCTYRWHVSSWTQCSVSCGDGTQHRHHACIGPQTQAPVPAGFCQHVPRPATVQSCWA
GPCTGQGTPSLAPRQEATAADLAVAAASLERPQPRAPASWLQGLLPGLQESPAEPSACGW
QHLEPTGTIDMRGPGQMDCAVAIGRPLGEVVTLQVLESSLNCRAGDMLLLWDRFTWRKTC
GKLSGSTFSSKTNTLVVRQRRTRPEGGVVLRYGSRPASGTPHRDCDMQHFGPSGEIVSPS
KSPDGSNLGGCRIFINVAPQARIAIYALTTDVGSGTGASYISIRDTHSLKTMTFRGQQAL
YWESEGSQAEMEFSQGFLEAHASLRGWYWTLQSRVQEPGWASL
Download sequence
Identical sequences M3YLK0
ENSMPUP00000012207 XP_012914025.1.14098 XP_012914026.1.14098 XP_012914027.1.14098 ENSMPUP00000012207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]