SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012310 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012310
Domain Number 1 Region: 404-491
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000639
Family DEATH domain, DD 0.0072
Further Details:      
 
Domain Number 2 Region: 126-183
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000118
Family TNF receptor-like 0.004
Further Details:      
 
Domain Number 3 Region: 61-104
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000123
Family TNF receptor-like 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012310
Domain Number - Region: 590-646
Classification Level Classification E-value
Superfamily DEATH domain 0.0102
Family Caspase recruitment domain, CARD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012310   Gene: ENSMPUG00000012404   Transcript: ENSMPUT00000012511
Sequence length 651
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:1335910:1405053:1 gene:ENSMPUG00000012404 transcript:ENSMPUT00000012511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSASSSTALASCSRVAGATMIAGSLFLLGFLSTTTAQPDPKAPNLVGKYRHVDHATGQ
VLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPRPMVEKLPC
AALTDRECACPPGMFQFNGTCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSV
MKCKAYTDCLSQNMVVIKPGTKEADNVCGPLLSSSTTSPAPGTAIFSHPEHMESHEVPSS
TYVPKGMNSTESNSSASVRPKVPSGIQEGTVPDNTSSARGEEGVNKTLPNLQVVSHQQGP
HHRHILKLLPSMEATGGEKSSTPIKGLKRGHPRQNLHKHFDINEHLPWMIVLFLLLVLVV
IVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSTTPTQNREKWIYYCNGHGIDILKLVAA
QVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQ
HRRNDVVEKIRGLMEDTAQLETDKLALPMSPSPLSPSPIPSPNTKLENSTLLTVEPSPLD
KNKGFFVDESEPLLRCDSTSSGSSALSRTGSFITKEKKDTVLRQVRLDPCDLQPIFDDML
HILNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
Download sequence
Identical sequences M3YLV3
ENSMPUP00000012310 XP_004739788.1.14098 ENSMPUP00000012310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]