SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012331 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012331
Domain Number 1 Region: 73-259
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-49
Family Astacin 0.00023
Further Details:      
 
Domain Number 2 Region: 430-602
Classification Level Classification E-value
Superfamily TRAF domain-like 8.83e-40
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 268-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-28
Family MAM domain 0.006
Further Details:      
 
Domain Number 4 Region: 675-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000262
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012331   Gene: ENSMPUG00000012425   Transcript: ENSMPUT00000012532
Sequence length 749
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:1754022:1788009:-1 gene:ENSMPUG00000012425 transcript:ENSMPUT00000012532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWMKFTCVLSFILFVAHIAAVSINHLSKGNEHDEEFHEQKGISEINLAAGLDLFQGDIF
LQNSRNGLRDPSTRWKFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQKFEGCWSEVGDHHVGQNLSIGQGCDYKAIIEHEILHALGFYHEQSRTDRDDYVNIWW
DEILPGFEHNFNTYDDTFITDLNTPYDYESLMHYEPFSFNKNDSAPTITAKIPEFNSIIG
QRLDFSATDLERLNRMYNCTTTHTLLDHCAFEKANICGMIQGTRDDADWVHEDGTQSGQV
DHTLVGQCRGAGYFMHFSTSSGMAEEAALLESRILYPKRKQQCLQFFYKMTGSPSDRLVV
WVKRDDSTGNVRKLVKLQTFRGDLDQNWKIAHVTLREEKKFRYLFQGTKGDPKNSNGGIY
LDDITLTETPCPAGVWTIRNISQVLQNTVPGQMLRSPRFYNSEGYGFGLTLYPNGRLNSS
SPGYLGLTFHLYSGENDAILEWPVENRQAVMTILDQEPDARNRMSSSMVFTTSRSHTSSA
INGSVIWDRPSIVGNYDNDCGCFRSIDWGWSNVISHQMLKRKSFLKNDDLILFVDFEDIT
YLNQTEVPAQGTRLSPQGLVLQDQEQQISEEYSGKVLLENALPSSLDQGQPGRQKRSVEN
TGPLEDHNWPQYFRDPCDPNPCQNEGICVNVKGMASCRCVSSHAFFYTGERCQAMQVHGS
ILGLLIGGTAGVIFLTFAIISMLSQRARQ
Download sequence
Identical sequences M3YLX4
ENSMPUP00000012331 XP_004739804.1.14098 ENSMPUP00000012331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]