SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012404 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012404
Domain Number 1 Region: 795-875
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-20
Family DEATH domain, DD 0.00016
Further Details:      
 
Domain Number 2 Region: 228-278
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000085
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 138-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000233
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 282-336
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000106
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 31-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000353
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012404   Gene: ENSMPUG00000012498   Transcript: ENSMPUT00000012605
Sequence length 885
Comment pep:novel scaffold:MusPutFur1.0:GL896898.1:5454632:5514427:-1 gene:ENSMPUG00000012498 transcript:ENSMPUT00000012605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLTVWLLGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAMPATQI
FFKCNGEWVRQVDHVIERSTDDGSGLPAMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSG
TTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPS
LDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVNGGWSTWTEWSV
CSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGSWSPWSKWSACGLD
CTHWRSRECSDPAPRNGGEECRGADLDTRNCTSDLCVHTASGPEDVALYVGLIAVAVCLL
LLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTTC
QGSLCPRQDGPSPKFQLANGHLLSPLGGGRHTLHHSSPTSEAEDFVSRLSTQNYFRSLPR
GTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQT
LLSPIVSCGPPGVLLTRPVILAMDHCGEPCPESWSLRLKKQSCEGSWEDVLHLGEEAPSH
LYYCQLEAGACYVFTEQLGRFALVGEALSVAATKRLKLLLFAPVACTSLEYNIRVYCLHD
THDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPF
YHIWNGTQQYLHCTFTLERVSPSTSDLACKVWVWQVEGDGQSFNINFNITKDTRFAELLA
LESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHLDSHLSFFASKP
SPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences M3YM47
ENSMPUP00000012404 ENSMPUP00000012404 XP_004737571.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]