SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012423 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012423
Domain Number 1 Region: 2899-3021
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-17
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily DHH phosphoesterases 1.1e-16
Family Manganese-dependent inorganic pyrophosphatase (family II) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012423   Gene: ENSMPUG00000012517   Transcript: ENSMPUT00000012624
Sequence length 3038
Comment pep:known scaffold:MusPutFur1.0:GL897068.1:1379679:1632679:-1 gene:ENSMPUG00000012517 transcript:ENSMPUT00000012624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFLQRAKSKLNRSKRLEKVHVVIGHKSCDLDSLISAFTYAYFLDKVSPPGVLCLPVLN
IPRTEFNYFTETRFILEELNISESFHIFRDEINLHQLNDEGKLSLTLVGSNVLASEDKTL
ESAVVKVINQVEQSDGGLEFQESSSSLVVKEILQEAPELITEQLAHLLRGSILFKWMTME
SEKISEKQEEILSILEEKFPSLPPREDIINILQETQFSAQGLSIEQTMLKDLKELSDGEI
KVAISTVNMTLENCMFHSNISSDLKAFADKFGFDVLILLASYLSEEEQPRRQIAVYSQNL
ELCSQICCELEECQNPCLELEPFECGCDEILVYQQENPLVTCDQVVLLIKEVINRRCPEM
ASNSRTSSTEAVAGSAPLSQGSSGIMELYGSDIEPQPSSVNFIENPPDLSDSNQAQVDGN
LDLVSPDSGLATIRSSRSSKESSVFLSDDSPVGEGAGPHHSLLPGFDSYSPIPEGAVAEE
HARSREHSESFDLFNFDQAPMASGQSQPSSHSADYSPADDFFPNSDSSEGQPHTGPKEIS
GIGMDMSNFSSSSLLSGAGKDNLVEFDEEFGQRQDSPRDHSERNLSLTGFVRDKTPSPER
LKNIGKRVPPTPMNSFVESSPSTEEPALLYPDNMTQKTIKTGHIGPPQTRARCSSWWGGL
EIDSKNIGEAWSSSEQESVFQSPESWKDHKPTPADRRASDSIFQPKSLEFPKSSPWESEF
SQPGLSSNNIQDRNEDSLQFQNVPQEKLNLPNASPQGTNHLIEDFAALWRSDRSPTAMPE
PWGNPTEDGDPAAAVSFPAWRAFGKEDGANALASTWHLHPTSGETPSVRDPSQWAMAKSG
FSFPSEDNSPSEAKNEEIWGQKNHNPRDNILVSGNPSSNLDHAWNSSKPTQEDQNGLVDG
KIRGKVYEKVDSWNLFEEGIKKGGSDAMAPWEDSFLYKCSDYSASNMGEDSVPSPLDTNY
STSDSYTSPTFAGDEKETEDKSFAKEGDLESKDENSTGGEIEIPPQSPEQQPRNRISSGP
GNLEMWGSPDADNSCSINVTHNSDKDLLETEPTDDKNISLDDDIGESSLSSYDDPSMMQL
YNETNRQLTLLHSNTNSRQAVPDSLDLWNRVILEDTQSTATISDMDNDLDWDDCSAGVAI
SSEGQAQGYTAEGPEPETRFSVRQLEPWGVEYQEANQADWELPASSEHSEDPPAKEYDTL
NEKSGQLIANNIWDSVMRDNDMSSLMIPGPPCVTDSELHKSPPETPNSSEKIKDNYIPEV
LEASGANESGTLDPDKQDTGRGTLPRDAASWASTLENPGHVAHSDPWKGPHYGQSEGEEE
ARGAVARERLSEEEMLDRTSEISGKGPSHQECSSPTASPHQEICDELGKISSHSATSSPQ
NEESQEVLEYESGSYNPDPCDGHTDLQVQETYDMHLMDYGNSGETTEISGGLKLTKTVSL
PEMDLEKTGKCNVLEPERVNKEPPHECPQSLDIWEASIETNTQVNLPSSEITKNPEVEST
KDSPPGADPSGNYRRDSISSEYTHSSASSPGLNDSSAALLSWDQGPNTRHQKQQQDDWNQ
QNPQESALITTDSQVEVITEMQDLEKTRMDRLEKSLDHKVPKFLEIWNDSLDGDSFSSLS
SPETGKYSEYSTACQEGNLVVSCQEKNEHDISKTLQPEEARFMATSSGSDDDSIGDEESG
EKERHLGTSQAAKSEPRAWDSLNDPNKFSATADPSDEFSAYGGSSEPTKSTPFCDSQPNS
PDHWSFSPLKETELQITAVGKEMRSPETARMGDTLWQISPQSESKTENYSKLEMLGFSAE
STEWWNASLQGGRPIESTSERELPSSSSMLEMSSSVYQNLSPWGVPMQDDREPMETQCTN
PFTEEPQSPFLDSNEENSHKQLWNIQPRQPDPEADQLSQLVILDQIKEKDSREQSSVSSA
GQEPTSETPTQDQECQSAVLSVWGQPDPTFTHTDEKGPVMSKVSTVECQETNWWEEGKSY
PDKITNSTTASKDFPTVSSSTELIKKSGSEWNVCTSSEGPQGTFVPDILHGNFQEGGQVV
AASPDLWLDAKQPFSLKADGENPDLLTHCDPDSNFQASNSPDICHDYEAKQDTEQHIQAG
VGPGGIAGELYLPEPKTDEEPSPEPGQEFVPSNPERSSEDVIPLPPVSDLVDTRGSSPPA
SHKASPEPSEISGGNNTDVQGSETGVAPDPALNLQLADRTSPMIENVGTGICVTLHEPTV
DSNSLPMSEGFPPESQTDAGALLDHEQPFATENSPAGPDALLASDTCLDVSEAAFDHSFS
DASGLNTSTGTIDDMSKLTLSEGNPETPVDGDAGKQDICSSEASWGDFEYDVMGQNIDED
LMKEPEHFLYGGDPPLEEDALKRSLAPYTPPFDLSYLTEPALGAQSTEEAGSPKDESLGS
EAAEILLSALPKQKSNEKHEETPNSQPGQLVVLHIHEGPEPEGAHSNLEWSPSNIDWEVE
TDNSDSPAGGDIGPPNGVGEGVSELEEEKVIPIKEPEQITPEYREERSTEKNEDRHALHM
DYILVNHEENSPPTPEARKARESTCESGEFPTGPEETGLPGTPLAGLSDSCQPVSFSGRE
DGSVETVSPKGDKDKRSSLESPGQDQSWMVLGHSEEGDQSLEARNSGPGGSGQVVELTSP
CGLGEGPHIQVLGGMKPVESLTLEEAPGLGSQSRKSKGRGRAGPDAVLGQAIRHDNEWEM
LPPQPSRKNRILETEMEEETEFLEPRTRKPRPKGLPTEDVGMDIPFEEGMPSPSATDMRP
EPPNSLDLNDAHPRRIKLTAPNINLSLDQSEGSILSDDNLDSPDEIDINVDELDTPDEAD
SFEYTGHEVSTSNKDSGQESESIPEYTAEEEREDNRLWRTVVIGEQEQRIDMKVIEPYRR
VISHGGDSGYYGDGLNAIIVFAACFLPDSSRADYHYVMENLFLYVISTLELMVAEDYMIV
YLNGATPRRKMPGLGWMKKCYQMIDRRLRKNLKSFIIVHPSWFIRTILAVTRPFISSKFS
SKIKYVSSLSELSELIPMDCIHIPESIINIDLKLKGKP
Download sequence
Identical sequences M3YM66
ENSMPUP00000012423 ENSMPUP00000012423 XP_012901140.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]