SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012452 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012452
Domain Number 1 Region: 34-63,180-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.7e-57
Family G proteins 0.0000000474
Further Details:      
 
Domain Number 2 Region: 63-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.44e-42
Family Transducin (alpha subunit), insertion domain 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012452   Gene: ENSMPUG00000012547   Transcript: ENSMPUT00000012654
Sequence length 355
Comment pep:novel scaffold:MusPutFur1.0:GL897068.1:2112151:2304839:-1 gene:ENSMPUG00000012547 transcript:ENSMPUT00000012654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARREFKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIHYVCEQNKENAQLIKEVEVDKVCAL
SRDQVEAIKQLWEDPGIQECYDRRREYQLSDSAKYYLTDIDRIAMPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTENIRFVFAAVKDTILQLNLREFNLV
Download sequence
Identical sequences M3YM95
ENSMPUP00000012452 XP_004772191.1.14098 ENSMPUP00000012452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]