SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012554 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012554
Domain Number 1 Region: 239-457
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.14e-88
Family Fibrinogen C-terminal domain-like 0.000000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012554   Gene: ENSMPUG00000012648   Transcript: ENSMPUT00000012757
Sequence length 461
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:4322676:4358365:1 gene:ENSMPUG00000012648 transcript:ENSMPUT00000012757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNDRWKTMGGASQLEDRPRDKPQWPSCGYVLCTVLLSLAVLLAVAVTGAVLFLNHTHAP
GTAPPPVVSTGPAGANSALVTVERADSSRLSILIDPRCPDLTDGFARLEGAQASVLQALA
EHREEPKLAGEQERELLDTLADQLPRLLARASELQAECTGLRKGLGTLGQGLSALQSEQG
RLIQLLSESQGHMAHLVNSVSDVLDGLQRDPGVGRPRIKADLQRPPARGLRPRGCPNGSP
PRDCLDVLLSGQQEDGIYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWE
AYRDGFGKLTGEHWLGLRRIHALTTQATYELHVDLEDFDNGTAYARYGSFAVGLFSVDPE
EDGYPLTVADYSGTAGDSLLKHGGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLN
GQYLRGAHASYADGIEWSSWTGWQYSLKFSEMKIRPVREDR
Download sequence
Identical sequences M3YMJ7
XP_004757160.1.14098 ENSMPUP00000012554 ENSMPUP00000012554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]