SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012562 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012562
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.38e-33
Family Protein kinases, catalytic subunit 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012562   Gene: ENSMPUG00000012656   Transcript: ENSMPUT00000012765
Sequence length 185
Comment pep:novel scaffold:MusPutFur1.0:GL896977.1:2615510:2662944:1 gene:ENSMPUG00000012656 transcript:ENSMPUT00000012765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNC
EYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKL
QEFNARRKLKAAVKAVVASSRLGSASSSHSGIQESQKASQASSLTQDGSEDVKAILEGEE
VQGAH
Download sequence
Identical sequences M3YMK5
ENSMPUP00000012562 ENSMPUP00000012562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]