SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012584 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012584
Domain Number 1 Region: 250-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-83
Family Protein kinases, catalytic subunit 0.000000000131
Further Details:      
 
Domain Number 2 Region: 141-281
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-36
Family SH2 domain 0.00000143
Further Details:      
 
Domain Number 3 Region: 81-166
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-20
Family SH3-domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012584   Gene: ENSMPUG00000012678   Transcript: ENSMPUT00000012787
Sequence length 1150
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:4371382:4501805:-1 gene:ENSMPUG00000012678 transcript:ENSMPUT00000012787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQPGKVVGDQRRPSLPALHFIKGAGKKESSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNALAELVHHHSTVADGLITTLHYPAPKRN
KPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVHGLMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGVAST
LLQAPELPTKTRTSRRAAEHKDPTEVPETPHSKGPGETEPLDHEPPVSPLLPRKERGPQY
GGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERKATSEEEGRET
SNGAPVLTPSDAAEPAKSPKPSSRAGVPNGAFRESGGAGFRSPHLWKKSSTLTSGRLAAS
EEESGSSASKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQVTRGTVTPPPRLVKKTEDAADEVFRDAGEASPGSSPPSLTPKLLRRQ
VAGASSSGLPHKDEVGKSGALGTIVAAEPVPATSRAGPGASGGAGKAPTEEPRARRHKPS
SESPGRDKGKLSKLKPVPPPPPPASAGKAGKPSQSQSQEAAGEAGAGGKAKAAAMVVDAV
NSDTVKPGPLGEGVKKPGLPSMPKPQSSSKPAGTPTSPAPAPSASPSASSALAGDQPAST
AFIPLISTRVSLRKTRQPPERIASGTITKGVVLDGTEALCLAISKNSEQMASHSAVLEAG
KNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS
VKEISDIVQR
Download sequence
Identical sequences M3YMM7
ENSMPUP00000012584 XP_004757162.1.14098 ENSMPUP00000012584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]