SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012594 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012594
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily SET domain 0.0000399
Family Histone lysine methyltransferases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012594   Gene: ENSMPUG00000012688   Transcript: ENSMPUT00000012797
Sequence length 116
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:4523878:4540416:-1 gene:ENSMPUG00000012688 transcript:ENSMPUT00000012797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPFTGRIIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQ
NLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHGR
Download sequence
Identical sequences M3YMN7
ENSMPUP00000012594 ENSMPUP00000012594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]