SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012617 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012617
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-25
Family Single strand DNA-binding domain, SSB 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012617   Gene: ENSMPUG00000012711   Transcript: ENSMPUT00000012820
Sequence length 173
Comment pep:novel scaffold:MusPutFur1.0:GL896993.1:4324699:4332647:1 gene:ENSMPUG00000012711 transcript:ENSMPUT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTG
RGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQSRGAHNEQKNNSMNNNMGTGTFGPVGNG
VQAGPESRGCQFSYAGRSNGRGPTHSQPQGTANNQTVMTTISNGRDPRRAFKR
Download sequence
Identical sequences M3YMR0
ENSMPUP00000012617 ENSMPUP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]