SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012661 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012661
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily DEATH domain 3.34e-21
Family Caspase recruitment domain, CARD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012661
Domain Number - Region: 210-451
Classification Level Classification E-value
Superfamily Tropomyosin 0.0163
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012661   Gene: ENSMPUG00000012756   Transcript: ENSMPUT00000012865
Sequence length 1028
Comment pep:novel scaffold:MusPutFur1.0:GL896907.1:12016341:12040605:-1 gene:ENSMPUG00000012756 transcript:ENSMPUT00000012865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLTRALNPAKLTPYLRQCRVIDEQ
DEEEVLSTYRFPCRVNRTGRLMDILRCRGKRGYEAFLESLEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLREQQQ
TQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLQ
VSRLEEECALLRRARGPPPGAEDKEKDKEPDGVELVSELRAENQRLAASLRELQEGLQQE
ASRLGAPGSERILLDILEHDWREAQDSRQELCQKLDAVQGELQWAEELRDKYLQEMEDLR
LKHRTLQKDCDLYKHRMATVLAQLEELEKERDQAIQSRDRIQLQYSQSLIEKDQYRKQVR
GLEAERDELLTSLTSLEGAKALLEAQLQRVQGGPCLKACASSHSLCSNLSSTWSLSDLPP
LLGGPEAAREVAVMGGSEPHTSEEATDSEKEINRLSILPFPPSAGSILRRQREEDPAPPK
RSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPDGPLARGCGLDLINRSLAIRVSC
RSPPGGPESHDKGPDGLSFLGDSWSGAVVRRVLSGPGSARVESREPRTEAAGLEGTSLEG
EVPQRTLPWNQVSTLPFLMDFKACQSFHEALDAWTKGLSTEPFYIRANLSLPERADPHAL
CVKAQEILRLVDPAYKRRPEWFCTRVDPLTLRDLDRGTVPNYQRAQQLLEVQEKGLFSSR
HRGSRSNLKKRALDQLRLVKPKHGGSSSGDSPEPLLPEPCSEPERSLRPYSLVRPLLVSA
LRPVVLLPECLASRLIRDLLDLPNSRLDFQVCPAESLSGEEQCSSAAPGAPKAQPATPGL
GSRLRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGRPGCR
DSELLRQCHRSEQVLWGLPCSWVQVPAHAWGHSEELAKVVRGRILQEQARLVWVERGSGG
GWGGSSEA
Download sequence
Identical sequences M3YMV4
XP_004743239.1.14098 ENSMPUP00000012661 ENSMPUP00000012661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]