SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012867 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012867
Domain Number 1 Region: 74-275
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-56
Family CRAL/TRIO domain 0.0000000345
Further Details:      
 
Domain Number 2 Region: 277-387
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.09e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.000000851
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.09e-21
Family CRAL/TRIO N-terminal domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012867   Gene: ENSMPUG00000012967   Transcript: ENSMPUT00000013076
Sequence length 400
Comment pep:novel scaffold:MusPutFur1.0:GL897019.1:1926086:1935890:1 gene:ENSMPUG00000012967 transcript:ENSMPUT00000013076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQAETLAKFRENVKDVLPALPNPDDYFLLRWLRARNFDLQKSEAMLRKYM
EFRKSMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDL
LKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEE
NYPETLKFMLIVLATKLFPVGYNLMKPFLSEDTRRKIIVLGSNWKEGLLKLISPEELPAQ
FGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPG
CVLRWQFSSDGADIGFGVFLKTKMGERQRAGEMTEVLPSQRYNAHMVPEDGSLTCSEAGV
YVLRFDNTYSFVHAKKVSFTVEVLLPDEGMQKYDKELTPV
Download sequence
Identical sequences M3YNG0
ENSMPUP00000012867 ENSMPUP00000012867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]