SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012881 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012881
Domain Number 1 Region: 18-178,270-333
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.86e-68
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 326-356,391-448
Classification Level Classification E-value
Superfamily SH3-domain 4.02e-16
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012881   Gene: ENSMPUG00000012981   Transcript: ENSMPUT00000013090
Sequence length 449
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:5818093:5833136:1 gene:ENSMPUG00000012981 transcript:ENSMPUT00000013090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAERTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPTTPYGKTLIKVAE
AEKRLGAAERDFIHTASINFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATCEGDTVPDFQETRPRNYILSASASATLDDTSCPPSWAEWKEEYPGGWRPPCFF
LLPLNPSVTRARGCLSLPKDRKLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTH
VNHLRCLHEFVESQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAA
TMPVGPSVAGLAPPGEAALRLEEVTPPASGTRKARVLYDYEAADSSELALLADELITVYS
LPGMDPDWLIGERGNKKGKVPVTYLELLS
Download sequence
Identical sequences M3YNH4
ENSMPUP00000012881 ENSMPUP00000012881 XP_004757195.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]