SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012924 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000012924
Domain Number - Region: 283-309
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0366
Family SIAH, seven in absentia homolog 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012924   Gene: ENSMPUG00000013023   Transcript: ENSMPUT00000013133
Sequence length 455
Comment pep:novel scaffold:MusPutFur1.0:GL896977.1:8421682:8453423:-1 gene:ENSMPUG00000013023 transcript:ENSMPUT00000013133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGKEKRVCNKLQQAFHHSKEPTFLLSQALLCGDSHSSLLPDTENVSHAGKIKTGPQKT
RPGTVILSQQSSRRIMSEGQPSPPVIPPRRPGFRVCYICGREFGSQSIAIHEPQCLEKWR
IENSKLPKNLRRPEPSKPQPLGGSGSYDLQAVNEAAFQSSQAQLLPCEYCGRTFLPDRLP
VHQRSCKPKDDGTRAPTLSSSDDGAGPRKAAGSIPVRPQTLTCYICGREFGTLSLPIHEP
KCLEKWKIENDRLPRELRRPLPQKLQPLPTGQSNQEGPSQTQLVPCPNCGRTFAPDRLLV
HQRSCKVQPSGPKIQDLTLGSKDALKESAKSKQQRNMAAPTVTDKPTMIRRPPTVICYIC
GREYGTKSIAIHEPQCLKKWHNENNLLPKELRRPEPKKPEVRTITAKGFYDLDALNEAAW
TSALSQLVPCNICGRTFLPDRLIVHQRSCKPKAAK
Download sequence
Identical sequences M3YNL7
ENSMPUP00000012924 ENSMPUP00000012924 XP_004761418.1.14098 XP_012916317.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]