SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012944 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012944
Domain Number 1 Region: 31-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000185
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000613
Family LIM domain 0.0016
Further Details:      
 
Domain Number 3 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000114
Family LIM domain 0.0079
Further Details:      
 
Domain Number 4 Region: 4-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000187
Family LIM domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012944   Gene: ENSMPUG00000013043   Transcript: ENSMPUT00000013153
Sequence length 204
Comment pep:novel scaffold:MusPutFur1.0:GL896902.1:5155928:5158668:1 gene:ENSMPUG00000013043 transcript:ENSMPUT00000013153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSVLSPGGHAEHNGRPYCHKPCYGA
LFGPRGVNIGGVGSYLYNPPTPTPASTTPLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGE
TSLCPGCEEPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHIPCYGYL
FGPKGVNIGDVGCYIYDPVEIKSK
Download sequence
Identical sequences M3YNN7
ENSMPUP00000012944 ENSMPUP00000012944 XP_004739900.1.14098 XP_006736740.1.47382 XP_021547745.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]