SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012979 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012979
Domain Number 1 Region: 139-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.91e-61
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 481-793
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.07e-40
Family Patatin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012979   Gene: ENSMPUG00000013075   Transcript: ENSMPUT00000013188
Sequence length 806
Comment pep:novel scaffold:MusPutFur1.0:GL896907.1:12518208:12578617:-1 gene:ENSMPUG00000013075 transcript:ENSMPUT00000013188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFFGRLVNTLSSVTNLFSNPFRVKEVAVADYTSSSRVQEEGQLILFQNIPNRTWDCILV
NPRNSQSGFRLFQLETEADALVNFQHYSLQLPPFYESSGHVLHVEVLQQLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANNRENEEGCTPLHLACRKGDGEILVELVQYCHAQMD
VTDNNGETAFHYAVQGDNAQVLQLLGKNASAGLNRVNNQGQTPLHLACQMGKQEMVRLLL
LCNARCNVMGSTGYPIHTAMKFSHKGCAEMIISMDSNQIHSKDPRYGASPLHWAKTAEMA
RMLLKRGCDVNSTSSTGNTALHVAVMRNRFDCVMALLTYGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDSGETPAFIASKISKLVTRKTLLTLLRTIGANYSLPLTQE
APSEQSSTTTHHSFSLERSQPPPISLNNLELQDIVHISRSRKPAFILSSMRDEKRTHDHL
LCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGV
YFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPAELHLFR
NYDAPESVREPRFSQNINLKPPTQPSEQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNP
TLDAMTEIHEYNQDMIRKGQRNKVKKLSIVVSLGTGKSPQVPVTCVDVFRPSNPWELAKT
VFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVDIQYFRLNPQLGTDIMLDEVSDAVLVN
ALWETEVYIHEHREEFQKLVQLLLSP
Download sequence
Identical sequences M3YNS2
XP_004743272.1.14098 XP_004743273.1.14098 XP_004743274.1.14098 XP_012907064.1.14098 ENSMPUP00000012979 ENSMPUP00000012979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]