SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012984 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012984
Domain Number 1 Region: 77-272
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-59
Family CRAL/TRIO domain 0.00000000409
Further Details:      
 
Domain Number 2 Region: 276-396
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.53e-37
Family Supernatant protein factor (SPF), C-terminal domain 0.000000376
Further Details:      
 
Domain Number 3 Region: 2-73
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.97e-22
Family CRAL/TRIO N-terminal domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012984   Gene: ENSMPUG00000013080   Transcript: ENSMPUT00000013193
Sequence length 403
Comment pep:novel scaffold:MusPutFur1.0:GL897019.1:1953698:1974258:-1 gene:ENSMPUG00000013080 transcript:ENSMPUT00000013193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRVGDLSPKQKEALAKFRENVQDVLPTLPNPDDYFLLRWLRARNFDLQKSEAMLRKHV
EFRKQKDIDNITSWQPPEVVQQYLSGGMCGYDLDGCPIWYDIIGPLDAKGLLLSATKQDL
LKTKMRDCERLLQECACQTKKMGKKVETITLIYDCEGLGLKHLWKPAVEAYGEFLCMFEE
NYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKYISPDQLPVE
YGGTMTDPDGNPKCKSKINYGGDIPKKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG
CVLRWQFTSEGSDIGFGIFLKTKMGERQRAGEMTEVLSNQRYNAHLVPEDGTLTCSDPGI
YVLRFDNTYSFIHAKKVSFTVEVLLPDKASEEKMKQLGAVTPK
Download sequence
Identical sequences M3YNS7
ENSMPUP00000012984 ENSMPUP00000012984 XP_004766495.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]