SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012988 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012988
Domain Number 1 Region: 316-417
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.44e-43
Family HIN-200/IF120x domain 0.00014
Further Details:      
 
Domain Number 2 Region: 418-504
Classification Level Classification E-value
Superfamily HIN-2000 domain-like 1.99e-31
Family HIN-200/IF120x domain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000012988
Domain Number - Region: 4-73
Classification Level Classification E-value
Superfamily DEATH domain 0.000214
Family DEATH domain, DD 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012988   Gene: ENSMPUG00000013084   Transcript: ENSMPUT00000013197
Sequence length 524
Comment pep:known scaffold:MusPutFur1.0:GL897121.1:1027145:1050611:1 gene:ENSMPUG00000013084 transcript:ENSMPUT00000013197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDYKRIILLKGLEAINEYQFSIVKSLLARDLRLTRKMQEEYNKVQIADLMERKFPGPA
CVDKLVKLFKDIEELGDVVKILKNEKKKVMRQSGARGKEPMKKRRQDSPRTDESTSTVNE
ASGSVHDTVMSKKKKIKTTQQDESMRTQPTQEQSPLPGPSATSTQSTCSYPQTPQMPPPT
PGSSSATKKKKMETTQNDGPMRTPPTQGQSPLPGPSATSTQSTCSYSQTLQMPAPTPGSS
STTKKKKMETTQNNESMRTPPTQGQSPLPGPSAMSTQSTCSYPQTLQMPAPTPGSSSTTK
KPRLKVVPTEASIEEGFQKGPKEVMVLKATEPFSYDPMKAEKKMFHATVATESQFFQVKV
FHVSLKNKFIPKNIIAISDYHGRNGFLELYDTSRVSDVNSDQKMEISSRLIQNAKATPKI
NTLYSQKPGTFVSGIYQVHKKNVLSENIILYEIQDNTGKIEVLVYGRLTNVNCEEGDKLR
LICFELSMDPRQLRSVIHSFIKVIKPRKNKKQPLGPDSHTEISL
Download sequence
Identical sequences M3YNT1
XP_004775866.1.14098 ENSMPUP00000012988 ENSMPUP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]