SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013046 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013046
Domain Number 1 Region: 745-888
Classification Level Classification E-value
Superfamily Spectrin repeat 1.95e-38
Family Spectrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 1717-1873
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-37
Family Spectrin repeat 0.00000146
Further Details:      
 
Domain Number 3 Region: 203-353
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-35
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 1824-1979
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-35
Family Spectrin repeat 0.00000219
Further Details:      
 
Domain Number 5 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-34
Family Spectrin repeat 0.0000586
Further Details:      
 
Domain Number 6 Region: 416-569
Classification Level Classification E-value
Superfamily Spectrin repeat 2.42e-32
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 7 Region: 1287-1432
Classification Level Classification E-value
Superfamily Spectrin repeat 2.42e-32
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 8 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 9 Region: 1929-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-29
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 10 Region: 1396-1520
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-28
Family Spectrin repeat 0.0000712
Further Details:      
 
Domain Number 11 Region: 1499-1650
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-27
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 12 Region: 677-780
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-26
Family Spectrin repeat 0.0000797
Further Details:      
 
Domain Number 13 Region: 2091-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 2313-2470
Classification Level Classification E-value
Superfamily EF-hand 5.86e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 15 Region: 2206-2321
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 16 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 1057-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-20
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 18 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013046
Domain Number - Region: 1208-1232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013046   Gene: ENSMPUG00000013143   Transcript: ENSMPUT00000013256
Sequence length 2477
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:6109180:6160732:-1 gene:ENSMPUG00000013143 transcript:ENSMPUT00000013256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGVKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEETIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSAAQIQVKREELIANWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLSILAEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MDDVATRRDALLSRRNALHERAMCRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMIARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGDAMVEEGHFAAEDVKAKLSELNQKWESLKSKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALRDQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIAVRQEQIDHQTRVTKEAGSVSLRMKQVEELYHSLLELG
EKRKAMLEKSCKRFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVCGMMPRDDTDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELDQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELARDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEVKEKLDILDRERAGLEKAWAQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQSFAEQLVAAGHYAKGDICSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDTGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLTQFVEHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWIHEKMTLVASEDYGDTLAAVQGLLKKHEAF
ETDFTVHKDRVNDVCSNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLEEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHIQSKAIEARHAALMKRWSQLLANSATRKKKLLEAQSHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAQADFSQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEA
LILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF
DKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFM
ISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRE
LPTAFDYVEFTRSLFVN
Download sequence
Identical sequences M3YNY9
ENSMPUP00000013046 XP_012914130.1.14098 ENSMPUP00000013046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]