SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013064 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013064
Domain Number 1 Region: 610-665
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000314
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 554-610
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000837
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 665-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 501-551
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000106
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 754-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000109
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 443-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000732
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013064   Gene: ENSMPUG00000013162   Transcript: ENSMPUT00000013275
Sequence length 807
Comment pep:novel scaffold:MusPutFur1.0:GL896930.1:5309532:5564793:1 gene:ENSMPUG00000013162 transcript:ENSMPUT00000013275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAPALLRLSRSPALLALALPLAAALAFSDETLDKVPKSEGYCSRILRAQGTRREGYTE
FSLRVEGDPDFYKPGTSYRVTLSAAPPSYFRGFTLIALKENREGDKEEDHAGTFQIIDEE
ETQFMSNCPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKK
LCEQDSMFDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHS
KNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAA
PSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSG
VTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPD
NVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPC
PDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTL
PTEETEKCTVNEECSPSSCLMTEWGEWDECSATCGMGMKKRHRMVKMSPADGSMCKAETS
QAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNEELEQVEKC
MLPECPIDCELTEWSQWSECNKSCGKGHMIRTRMIHMEPQFGGAPCPETVQRKKCRVRKC
LKNPSIQKLRWREARESRRSEQLREESEGEPFPGCRMRPWTAWSECTKLCGGGIQERYMT
VKKRFKSSQFSSCKDKKEIRACNVHPC
Download sequence
Identical sequences M3YP07
ENSMPUP00000013064 XP_004752080.1.14098 ENSMPUP00000013064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]