SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013148 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013148
Domain Number 1 Region: 6-61
Classification Level Classification E-value
Superfamily Chromo domain-like 1.37e-18
Family Chromo domain 0.00098
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013148
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Fibronectin type III 0.071
Family Fibronectin type III 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013148   Gene: ENSMPUG00000013246   Transcript: ENSMPUT00000013359
Sequence length 251
Comment pep:novel scaffold:MusPutFur1.0:GL896907.1:13199841:13216935:-1 gene:ENSMPUG00000013246 transcript:ENSMPUT00000013359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA
GAPELVDKGPLVPALPFPLRKPRKAHKYLRLSRKKFPPRGPDLESHSHPRELFLQEPAAP
DVLQAASEWEPAEQPPEEEADGDLAEGPPPWTPVLPPSEVTVTDITANSVTVTFREAQAA
EGFFRDRGGKF
Download sequence
Identical sequences M3YP91
ENSMPUP00000013148 ENSMPUP00000013148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]