SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013178 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013178
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-42
Family Cyclophilin (peptidylprolyl isomerase) 0.00000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013178   Gene: ENSMPUG00000013276   Transcript: ENSMPUT00000013389
Sequence length 131
Comment pep:novel scaffold:MusPutFur1.0:GL897172.1:775532:775948:1 gene:ENSMPUG00000013276 transcript:ENSMPUT00000013389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKVPETAENFHALNIGKRFGFNGSYFHRIILGFLCQDGDFIGHHSTGGKSINNFILKHMG
PGILSVANVEPHTDSSQFFICPAKTGWLNGKHVVFGKVKDNMDITEAMERFGSRNSKKIS
KKVTIADCGQI
Download sequence
Identical sequences M3YPC0
ENSMPUP00000013178 ENSMPUP00000013178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]