SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013192 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013192
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily TRAF domain-like 1.16e-45
Family MATH domain 0.000000112
Further Details:      
 
Domain Number 2 Region: 180-295
Classification Level Classification E-value
Superfamily POZ domain 2.29e-34
Family BTB/POZ domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013192   Gene: ENSMPUG00000013290   Transcript: ENSMPUT00000013403
Sequence length 417
Comment pep:novel scaffold:MusPutFur1.0:GL897172.1:824093:884889:-1 gene:ENSMPUG00000013290 transcript:ENSMPUT00000013403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSREPSPPLPGDMSTGPIAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSS
PSDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGHTNTNTLK
VPECRLAEDLGNLWENTRFTDCSFFVRGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDVDPEVFKEMMRFIYTGKAPNLDKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADTLVLADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSKMICLCFIIFQNQRSV
DGVKNLSCFCQAADIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
Download sequence
Identical sequences M3YPD4
XP_012904356.1.14098 XP_012904357.1.14098 XP_012904358.1.14098 ENSMPUP00000013192 ENSMPUP00000013192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]