SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013286 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013286
Domain Number 1 Region: 320-503
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-47
Family CRAL/TRIO domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 233-316
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.14e-22
Family CRAL/TRIO N-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 523-688
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.7e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013286   Gene: ENSMPUG00000013385   Transcript: ENSMPUT00000013498
Sequence length 778
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:4267133:4330417:-1 gene:ENSMPUG00000013385 transcript:ENSMPUT00000013498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKYQSPVRVYKHPFELIMAAYERRFPTCPLIPMFVDSDTVNEFKSEDGAIHVIERRCK
LDIDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAHNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WTPPSIAPSSEASSSCKKQAASLAVVVPDAAQAEGLGSEALSSPSGPPEPTAGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREILCQ
SLTWRKQHQVDYILETWRPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTEVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLRLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDRVWQ
LGRDYSMVESPLICREGESVQGSHVTRWPGFYILQWRFHSMPACAATNLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSQSSSMISRESNAS
LRVQSTSLRRRQQGCSRVTGACFSSEGAAARGPGPAFLPLRLASALRVLLVSPMLLVS
Download sequence
Identical sequences M3YPM8
ENSMPUP00000013286 ENSMPUP00000013286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]