SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013296 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013296
Domain Number 1 Region: 133-181
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 2 Region: 253-304
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000109
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 185-245
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000222
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 75-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000011
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 308-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000641
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 376-409
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013296   Gene: ENSMPUG00000013395   Transcript: ENSMPUT00000013508
Sequence length 465
Comment pep:novel scaffold:MusPutFur1.0:GL896945.1:9851339:9859583:-1 gene:ENSMPUG00000013395 transcript:ENSMPUT00000013508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRGHVPQLLLLLLILLPATDSATVFCYTEYEESSGMCKGLLGGGVSVKDCCLNPAYGF
QEPGSKLCQACRLPRWSQWSAWAPCSVTCTEGSQLRHRRCIGHGGQCAEKVEPGTLEWQL
QACKDQPCCPEMGGWSNWEPWTPCSVTCSKGTRTRQRACNQPAPKCGGHCPGTPQESEAC
DTEQVCPIHGAWAAWGPWGPCSGSCNGGPKAPTQRRSRMCSAPEPSKEPPGKPCPGSEHD
TRPCSSLPPCPVAGGWGAWGPMSSCPVTCGLGQTLESRKCDHPAPQHGGLPCAGENTRTH
ICNTAVSCPVDGEWTSWEEWSPCTRRSVGSISCMEIPGQQSRSRSCKGRDFGGRRCPGEQ
QDIRHCYDIQRCRLKGSWSEWSSWGLCMPPCGPNPVRTRQRRCTAELPKFAPTITVVEGQ
GEKNMTFWGTPFPRCEPLQGQRLVVEEERPCLHVPACQDPADEKL
Download sequence
Identical sequences M3YPN8
ENSMPUP00000013296 ENSMPUP00000013296 XP_004755042.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]