SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013334 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013334
Domain Number 1 Region: 347-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-58
Family Nucleotide and nucleoside kinases 0.0000153
Further Details:      
 
Domain Number 2 Region: 194-337
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-34
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 122-210
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-16
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000177
Family L27 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013334   Gene: ENSMPUG00000013435   Transcript: ENSMPUT00000013548
Sequence length 554
Comment pep:known scaffold:MusPutFur1.0:GL896907.1:14488000:14595642:-1 gene:ENSMPUG00000013435 transcript:ENSMPUT00000013548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLDNLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLMNADENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSCINMERHPAHVRQVFVKCHFDY
NPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAF
VRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGA
QGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLE
HGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRA
MHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEK
LRMEPQWVPISWVY
Download sequence
Identical sequences M3YPS6
ENSMPUP00000013334 XP_004743373.1.14098 ENSMPUP00000013334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]