SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013387 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013387
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-26
Family Kringle modules 0.0009
Further Details:      
 
Domain Number 2 Region: 184-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013387   Gene: ENSMPUG00000013489   Transcript: ENSMPUT00000013602
Sequence length 444
Comment pep:known scaffold:MusPutFur1.0:GL897019.1:3047828:3097132:-1 gene:ENSMPUG00000013489 transcript:ENSMPUT00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECFTANGVDYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNPDGD
VSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGASKTSNKLTIQTCISF
CRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILFDTL
VGACGGNYSATTSVVYSPDFPDTYATGRVCYWTIRVPGASHIRFSFTLFDIRDSADMVEL
LDGYTHRVLVRFNGRNRPPLSFNVSLDFVILYFFSDRINQAQGFAVLYQAVKEEAPQERP
TANQTLAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSSSQTPTKGVEATGLEG
GWTVYGLATLLILTVTAVVAKILLHVTFKSHRVPASGDLRDCHQPGTSGEIWSIFYKPST
SISIFKKKLKGQSQQDDRNPLVSD
Download sequence
Identical sequences M3YPX9
ENSMPUP00000013387 ENSMPUP00000013387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]