SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013469 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013469
Domain Number 1 Region: 70-139
Classification Level Classification E-value
Superfamily TPR-like 5.46e-23
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013469   Gene: ENSMPUG00000013572   Transcript: ENSMPUT00000013685
Sequence length 150
Comment pep:novel scaffold:MusPutFur1.0:GL897019.1:3483235:3534189:1 gene:ENSMPUG00000013572 transcript:ENSMPUT00000013685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXPPAPDPTTGATPARNRRRREPESPPAPAPIPLFGAKTIGRRSPDG
PVLSKAEFVEKVRQSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDK
ALDDAIKARLLNPKWPKVEISFTFAESFLC
Download sequence
Identical sequences M3YQ61
ENSMPUP00000013469 ENSMPUP00000013469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]