SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013554 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013554
Domain Number 1 Region: 67-325
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.91e-40
Family PhyH-like 0.074
Further Details:      
 
Domain Number 2 Region: 900-957
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.52e-22
Family Tudor domain 0.0000527
Further Details:      
 
Domain Number 3 Region: 958-1013
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.01e-16
Family Tudor domain 0.0000513
Further Details:      
 
Domain Number 4 Region: 734-770
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000199
Family PHD domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013554
Domain Number - Region: 820-869
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00576
Family PHD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013554   Gene: ENSMPUG00000013657   Transcript: ENSMPUT00000013771
Sequence length 1066
Comment pep:known scaffold:MusPutFur1.0:GL896903.1:5662815:5708723:-1 gene:ENSMPUG00000013657 transcript:ENSMPUT00000013771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASESEALNPSARIMTFYPTMEEFRNFSRYMAYIESQGAHRAGLAKVVPPKEWKPRASYD
DIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERK
YWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLKTILDLVEKESGITIEGVNTPYLYFGM
WKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRH
KMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDSTVIDHTLPTPEAAEFLKESELP
PRARNEECPEEDDMEGLEDGEEGDLKRSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEEL
SSGQYDVAECQAALAPVRPTHSSVRQVEDALPFPDYSDSSEVKFEELKNVKLEEEDEEEE
EEQEAAALDLSVNPASLGGRLVLSGSKKKSSSSLGSGSSRDSISSDSETSEPLSCRAQGQ
SGVLTVHSYAKGDGRVTVGEPCTRKKGGATGSISERELTEVADEYMFSLEENKKSKGRRQ
PLSKLPRHHPLVLQDCVSDDESSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFN
ETMAQQAPHCAVCMIFQTYHQVEFGGLSQSCGNTSALAVQKQRTKPLIPEMCFTSTGCST
DINLSTPYLEEDGTSLLVSCKKCSVRVHASCYGVPPAKASEDWMCSRCSANALEEDCCLC
SLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPRFKLKCVFCKKRRK
RTAGCCVQCSHGRCPTAFHVSCAQAAGVVMQPDDWPFVVFITCFRHKIPSLERAKGALQS
ITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQLGPPA
EGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRL
SVASDMRFNEIFTEKEVKQEKKRQRVINSRYREDYIEPALYRAIME
Download sequence
Identical sequences M3YQE5
XP_004740622.2.14098 XP_004740624.1.14098 ENSMPUP00000013554 ENSMPUP00000013554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]