SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013597 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013597
Domain Number 1 Region: 436-522
Classification Level Classification E-value
Superfamily DEATH domain 3.53e-19
Family DEATH domain, DD 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013597   Gene: ENSMPUG00000013700   Transcript: ENSMPUT00000013814
Sequence length 550
Comment pep:known scaffold:MusPutFur1.0:GL896902.1:7113929:7124223:1 gene:ENSMPUG00000013700 transcript:ENSMPUT00000013814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISCHPHNHLERSLALAGPGVQGNWQHQGTTRMCSDESAFQPAHFLLLVGVPVASALLLV
QCLRWHCPRWLLGACWKLDSQEEPVAHPTPLPENESSRQCAPATLPEMAAFYQELHTPTQ
GQTIIRQLMHKLLVFSAREVDHRGGCLMLQDMGISLLIPPGAVAVGRQERVSLILVWDLL
DAPSLSRAQGLVSPVVACGPHGASFLKPCTLTFKHCAQEPSHARTYSSNTTLLDAKAWRP
LGRPGAHTSRDECRIQLSHFSLYTCVLEVPAGRDARKWLQLAIFCSPLAPGQSHLQLRIY
FLNNTPCALQWAVTNEQPHGGRLRGPCQLFDFTGARGDQCLKLTYISEGWENVDESSCQL
VPHLHIWHGKCPFRSFCFRRKAANENDDCSTLTSEIIVTMHTFQDGLETKYMEILRFQAS
EEESWAAPPPVSQPPPCNRLPPELFEQLQMLLEPNSITGNDWRRLASHLGLCGMKIRFLS
CQRSPAAAILELFEEQNGSLQELHYLMTIMERLDCASAIQNYLSGTHSGSPAPVRGGAQE
NQGLELDEKL
Download sequence
Identical sequences M3YQI8
ENSMPUP00000013597 ENSMPUP00000013597 XP_004740033.1.14098 XP_004740034.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]