SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013672 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013672
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily PH domain-like 5.74e-29
Family GRAM domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013672   Gene: ENSMPUG00000013775   Transcript: ENSMPUT00000013889
Sequence length 264
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:5321241:5328202:1 gene:ENSMPUG00000013775 transcript:ENSMPUT00000013889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGETMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYR
IIFLSKGRDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGAASYKLTFTA
GGAIEFGQRMLQVASQASRGEAPNGAYGYSHMPGGAYVFPPPFANGMYPCPPGYPYPPPP
PEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGN
PHNVYMPTNQPPPPPYYPPEDKKT
Download sequence
Identical sequences G9KXL2
ENSMPUP00000013672 ENSMPUP00000013672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]