SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013700 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013700
Domain Number 1 Region: 606-776
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000664
Further Details:      
 
Domain Number 2 Region: 33-246
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 262-331,389-423
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 466-572
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000128
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013700   Gene: ENSMPUG00000013803   Transcript: ENSMPUT00000013917
Sequence length 822
Comment pep:novel scaffold:MusPutFur1.0:GL896917.1:2400766:2484646:-1 gene:ENSMPUG00000013803 transcript:ENSMPUT00000013917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEEEAIGFLDKVLEDEDVFLLEECELGTPTSPGSGSPFLVAVKVEAGKGLEMRKLVLS
GFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNL
CPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKV
KGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNF
LSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTS
AGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKAN
KGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKL
QKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFK
QSANLYCTLEVDSFGYFVSKAKTRVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKT
KVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTP
SKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAA
FDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCM
MHLLRTLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLT
SAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences M3YQU1
XP_004746963.1.14098 ENSMPUP00000013700 ENSMPUP00000013700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]