SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013704 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013704
Domain Number 1 Region: 178-301
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 2.62e-59
Family Dystroglycan, domain 2 0.000000362
Further Details:      
 
Domain Number 2 Region: 59-157
Classification Level Classification E-value
Superfamily Cadherin-like 5.18e-19
Family Dystroglycan, N-terminal domain 0.00000352
Further Details:      
 
Domain Number 3 Region: 493-594
Classification Level Classification E-value
Superfamily Cadherin-like 6.91e-19
Family Dystroglycan, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013704   Gene: ENSMPUG00000013807   Transcript: ENSMPUT00000013921
Sequence length 891
Comment pep:novel scaffold:MusPutFur1.0:GL896974.1:1127361:1150118:-1 gene:ENSMPUG00000013807 transcript:ENSMPUT00000013921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSAGLSLPLPLWGRTFLLLLSVTVAQSHWPSEAGRDWENQLEASMHSVLSDLHEAVPT
VVGIPDGTAVVGRSFRVTIPADSVASNGELIKVSTAGKEALPSWLHWDPQSHTLEGLPLD
TDKGVHYISVSATRLGANGSHVPQSSSVFSIEVYPEDHSEPQSVRAASPEPAEAASSACA
ADEPVTVLTVILDADLTKMTPKQRLDLLHRMRSFSEVELSNMKLVPVVNNRLFDMSAFMA
GPGNAKKVVENGALLSWKLGCSLNQNNVPDIRGVEAPAREGAMSAQLGYPVVGWHIANKK
PPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETLAPPVRDPVP
GKPTVTTRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPPTTT
TKKPRVSTPKPATPSTDSSTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRTTT
SGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLREQQ
LVGDKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGDRA
PARFKAKFVGDPAPLVNDIHKKIALVKKLAFAFGDRNCSTVTLQNITRGSIVVEWTNNTL
PLEPCPKEQITGLSRRIAEDDGKPRAAFSNALEPDFKAMSISVTGAGSCRHLQFIPMAPP
KRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLT
LEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQ
DTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences M3YQU5
XP_004760705.1.14098 ENSMPUP00000013704 ENSMPUP00000013704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]