SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013734 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013734
Domain Number 1 Region: 2-717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-189
Family Motor proteins 0.0000000261
Further Details:      
 
Domain Number 2 Region: 1623-1711
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000139
Family SH3-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013734   Gene: ENSMPUG00000013837   Transcript: ENSMPUT00000013951
Sequence length 1742
Comment pep:novel scaffold:MusPutFur1.0:GL896922.1:5529403:5555570:-1 gene:ENSMPUG00000013837 transcript:ENSMPUT00000013951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSSALLCLKKRFHLGRIYTFGGPLLLSLNPHRPLPLFSAEVLASYHPKRAPNTTPHILAI
AASAYDRLSRSSGQGTCILLGGHSGSGKTEAARKIVQFLSSLEQEQTRDRRCHLDGVLPV
LSSFGHAKTVLNANASRFGQVFCLCVQNGVIVGASVSHYLLETSRVVFQAQAERSFHVFY
ELLAGLDPAEREKLSLQGPETYSYLNQGQACCLQGKDDARDFEGLRKALQVLCPEEVTAA
WAVLAAVLHLGNICFSSSERESQEVAAVSSWAEIHAAARLLLVPPECLEGAVTRRVTETP
YGWVCRSLPVESAVDARDALAKALYSRLFTWLLERSNAQLAAPGEGEHVDTITVVDVYGF
EALRVNGLEQLCNNLASERLQLFSSRLLWAQEEEACRRELLAWVPVPQPVWDTCLDLLVD
QPHSLLRLLDAQTWLPQATDHTFLQKCHYHHGSHPCYSKPQLPLPIFTVRHCAGTVTYQV
HKFVNRNRDHLDPAAVAMLAQSQLQVPLPALSEPPPLHTVSPHLPESQSTAGPDKPTLAS
RFQHSLEDLLARLGRSHVYFIQCLTPNPGKLPGLFDVGHVAEQLHQAGILEAVRTRSANF
PVRLPFQAFLARFRALETEAQGESSDRERCGAILSHVLGAESPLCHLGLERVLLREPGWQ
QLEQHRAQRRSQALLALHGSLRTCISRQRLSRLLLPQMQARVRGLQARKRYLRRRAALGQ
LSTVLLVARPLLRRRQRLQELGRLEIPAEVAVLLKTAEGHHHALDGSITESMPPEVPART
SLSLPPDIDQFPFSSFISTNFQEPALPSPGQLLAEPLTRLHGENPQHALDINKVMLRLLG
DGTLLPWQEQSMGEYLVRQGQRRPGLRDEIFSQLVAQIWHNPDEQQTQRSWALMAILLSA
FPPMPPLQKPLLKFVSDQAPTGMAALCQHKLLGALEQAHLAPGMARAHPPTQLEWTAGRR
RGRMALDIFTFNEECYSAEVESWTTGEQFAGWILQSRGLELPPRGWSVSLHSGDSWQDLV
GCDFVLDLIGQTEDLGDPVSPHSYPIAPRGLLDTTPIQGTPLAGPTVSHRDEDIAPAPGI
QAPSLPDPPPGPAPALPSRIQSGKARMGTVRLPVCPIGESQNSGNLDGFLDHLFQPVLSP
GHRDLEQAWALSSRLKGGGAVGPMRQGSYPMAMVMPPQPPPAPQPLLPSVDPRQLAAQQQ
SFINQQALLLAQQMTTQAMTLSLEQQTQWRWRQAQPQAQAPGAASPTSPPPVAPKPKKPL
ALQREPEREVESSVPSPPPPRVVTSAPTQGRVKAAQEAEAKPAAQRAGPGGHPAPAPHQR
AEPSREIRNIIRMYQSRPGPVPMPVQPARKPPKNFLKKNNPKDEALGPSPRGMASHLGGP
GLSGTQLRTCFVPPQTPSPSPGKGPAPAVAPRPKFPPQKPLRAQRYKLLVPSGSVCFSYL
NPSWRLFLRKEVFYPRENFSHPYCLRLLCEQILKDTFAESCVRISQEERSKMKELLGHLE
VGLESLSTTEDSVKKRIVVAARDKWANYFSRIFPVSGESGSDVQLLGVSHRGLRLLKMTK
GPSLHPSQLKTLCSYSFAELLGVECLGRSTLELTLKSEQLVLHTARASAIKAMIELFLSE
LKKDSGYVIALRSYITDDHSLLSFHRGDLIKLLPVATLEPGIPGGGQGSRHGEGSTWPSR
GRAEGPGWQFGSTGGRSGLFPADIVQPAAAPDSSFSPERSGRRKSRLQPREPGLAQWERA
AE
Download sequence
Identical sequences M3YQX5
ENSMPUP00000013734 ENSMPUP00000013734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]