SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013760 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013760
Domain Number 1 Region: 282-501
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.1e-90
Family Fibrinogen C-terminal domain-like 0.0000014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013760
Domain Number - Region: 168-221
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00183
Family SNARE fusion complex 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013760   Gene: ENSMPUG00000013863   Transcript: ENSMPUT00000013977
Sequence length 507
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:7333557:7353034:1 gene:ENSMPUG00000013863 transcript:ENSMPUT00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPCVTYWWLGWLGWLAAVGAAAGRKEGFEGAAAGRKEGFEGAEEGSPGEFIYLNRYKR
AGESSDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNSELLKQKRQIETL
QQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQT
ADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPAARPMPQPPPATPPRVYQ
PPPYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGH
DTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGE
YWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGD
SFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGV
YWAEFRGGSYSLKKVVMMIRPNPNTFH
Download sequence
Identical sequences M3YR01
ENSMPUP00000013760 ENSMPUP00000013760 XP_004757338.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]