SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013771 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013771
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-61
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 2 Region: 553-622
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.43e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 484-549
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-16
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 
Domain Number 4 Region: 267-346
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000144
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013771   Gene: ENSMPUG00000013874   Transcript: ENSMPUT00000013988
Sequence length 1203
Comment pep:novel scaffold:MusPutFur1.0:GL896922.1:5605780:5618778:1 gene:ENSMPUG00000013874 transcript:ENSMPUT00000013988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGREQDLILAVKNGDVTGVQKLVAKVKAAKTKLLGSTKRLNVNYQDADGFSALHHAALGG
SLELIALLLEAQATVDIKDSNGMRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLH
LAAQYGHYEVSEMLLQHQSNPCLVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGE
AKDPCDPNYTTPLHLAAKNGHREVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLL
LEGGVDVNIRNTYNQTALDIVNQFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTA
LNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRVGYFPPGIVEVVSKRVGVLAPRLPSAP
TPLRPGFSRTPQPPAEDPLHPLTYGQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQ
SSEGTNGHGTGLLIENAQPLPSTGEDQVLPGLHPPSLADNLSHRPLTNYRSGEQLFTQDV
RPEQLLEGKDAQAIHNWLSEFQLEGYTTHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRK
KIASEIAQLSIAEWLPNYIPVDLREWLCALGLPQYHKHLVSSGYDSMGLVADLTWEELQE
IGVNKLGHQKKLMLGVKRLAELRRGLLQGEAPAEGGRRLARGPELMAIEGLENGDGPAAA
GPRLLTFQGSELSPELQAAMAGGGPEPLPLPPARSPSQESIGARSRGSGHSQEQPTPQPG
GGDPGTPQERNLPEGTERPPKLCSPLPGQGAPPYVFMYPQGSPSSPAPGPPPGAPRAFSY
LAGPPATPPDPPRPKRRSHSLSRPGPEDGEAEGEAEGSVGSALGSYATLTRRPGRSALAR
TSPSPTPARGAPHSQSFALRARRKGPPPPPPKRLSSVSGPPTEPPPVDGSPGPKEGASVP
RRRTLSEPAGPLEPPSPPAPAGPVSDTEEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIKQ
RPKPAGPPSREAPVPAGLDFNLTESDTVKRRPKCREREPLQTALLAFGVAGATPSASASL
PSQPPGEPPSSSAAPSPPRPDPSSLPTQGAPEPLSPGLPAQPPVAPSPGPALENSAGGGQ
PGETEPPASPAALIKVPGAGTAPKPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGAA
GSGRAQQRLEQTSSSLAAALRAAEKSIGAEEREGPPGTSTKHILDDISTMFDALANQLDA
MLD
Download sequence
Identical sequences M3YR12
ENSMPUP00000013771 XP_004748988.1.14098 XP_004748989.1.14098 ENSMPUP00000013771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]