SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013834 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000013834
Domain Number - Region: 742-815
Classification Level Classification E-value
Superfamily DEATH domain 0.0121
Family DEATH domain, DD 0.013
Further Details:      
 
Domain Number - Region: 574-621
Classification Level Classification E-value
Superfamily SH3-domain 0.0828
Family SH3-domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013834   Gene: ENSMPUG00000013939   Transcript: ENSMPUT00000014054
Sequence length 852
Comment pep:known scaffold:MusPutFur1.0:GL896907.1:18388532:18454197:1 gene:ENSMPUG00000013939 transcript:ENSMPUT00000014054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITNKRSQFCLEGISRSKSEGNLFDMEAQKSSRNFHVTESTDPGFLLHWPDPFTCQGNKA
SEVTNPFWNELSASNPFLDDITQLRNNQKRENISILKEDPFLFFRETETGNSFDSSGDEL
DVHQLLRQSSSRTSARSKSVSELLDILDDTAHAHQNIHNSGQILEQDLEWLQNDREAYKM
AWLSRRQLARSCLDLNIINQSPGWAQTQVAETVIVCKVSHQGGSVQLPESGITVHVPQGH
VAVGEFQEVSLRAFLEPPQMLNHDLSCTVSPLLEITLGNLNTMEAVLLEMKIGAKVRKDP
FSQVMTEMVCLHSPGKEGPFKVLNNCYIYKDIIQVKLIDLSQVTYLVVAAQIKAIQSPAA
TIWDCIHKTTSIGIYGPRYIHPSFTVIFTVCGHCYMPGKLTISDMKKGAKNTSPVVFQLW
GKHSFLLDKPQDLSISVFSCDPDFEVKAERERKEIKQKQLLAGEVVHQQFLFSLADSREM
HIFVFRVQVEPPNGRAVTQFFVTTPDPAPNLKRLSNRLGDLQEEKKIKSAPLLPAVCVKY
PTFQDKKMNFTNYGITVKTVLRQKKIDYLLEYFKGDTVALIGEGKVKAIGQSKVKEWYVG
VLRGKVGLVHCKNVKVIEKEQVISMSNNVFTTRNLLEQITLPFKKLTYIYSVVLTSVSEK
VYDWKVLAEVLGYSHLALEGFDQTQADKESEKVSYIVKKLKEDCHADKNTRKFLYELIVA
LLKMDCQGLVAHLIQEAAILTSAVKLGKSWRELAEKLVQLTKQQMEAYEIPHRGKAGDVA
AEMMWKPAYDFLYTWGAHHGNSYRDVLQDLQSALDRMKNPVTKQWRDLTGALILIHSLEF
LRATAFSTSDEV
Download sequence
Identical sequences M3YR75
ENSMPUP00000013834 ENSMPUP00000013834 XP_004743428.1.14098 XP_012907137.1.14098 XP_012907138.1.14098 XP_012907139.1.14098 XP_012907140.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]