SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013843 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000013843
Domain Number - Region: 123-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0707
Family Cold shock DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013843   Gene: ENSMPUG00000013948   Transcript: ENSMPUT00000014063
Sequence length 355
Comment pep:known scaffold:MusPutFur1.0:GL896907.1:18789182:18820699:1 gene:ENSMPUG00000013948 transcript:ENSMPUT00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGCSEAPPPKAASEGPVVGQAGVLPCLELPTYAAACALVSSRYSCLVAGPHRRHIALS
PRYLNRKRTGIREQLDAELLRYSESLLGVPIAYDNIKVVGELGDIYDDQGHIHLNIEADF
VIFCPEPGQKLMGTVNKVSSSHIGCLVHGCFNASIPKPEHMPAEQWQNLEINVGDELEFE
VFRLDSDAAGVFCIRGKLNITSLQTKCSGVSEEITETGPEEITEKPLKKKKKKKKDPESY
EVESGNRELADYADATMNKETDLQIDNDLWKDAPKKKKKKKHQEDQDQDPVFQGSDSSGY
QSDHKKKKKKRKHSEEAEFTPLLEHSPKKKREKLYANKLDNLEEMGTFLEISKKL
Download sequence
Identical sequences M3YR84
ENSMPUP00000013843 ENSMPUP00000013843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]