SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013860 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013860
Domain Number 1 Region: 88-99,174-423
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-50
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 15-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013860   Gene: ENSMPUG00000013965   Transcript: ENSMPUT00000014080
Sequence length 437
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:9429083:9492989:1 gene:ENSMPUG00000013965 transcript:ENSMPUT00000014080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METWEVSVPDDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNC
VMSRKQRNRCQYCRLLKCLQMGMNRKAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEF
EEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSRSVELNGFMAFREQYMGMSVPPHY
QYIPHLLSYSAHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAVTQAEL
FALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGE
LADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIR
GLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVPLEQLP
LLFKVVLHSCKTSVGKE
Download sequence
Identical sequences M3YRA1
ENSMPUP00000013860 XP_004757401.1.14098 ENSMPUP00000013860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]