SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013861 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013861
Domain Number 1 Region: 9-177
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.03e-120
Family Cyclophilin (peptidylprolyl isomerase) 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013861   Gene: ENSMPUG00000013966   Transcript: ENSMPUT00000014081
Sequence length 177
Comment pep:known scaffold:MusPutFur1.0:GL896903.1:6643008:6653058:-1 gene:ENSMPUG00000013966 transcript:ENSMPUT00000014081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
Download sequence
Identical sequences A0A096MU77 A0A0D9S7K8 A0A1D5Q8U3 A0A1S2ZXJ4 A0A1S3F6G9 A0A1U7QQG3 A0A1U7UZG3 A0A212CHQ3 A0A250YB86 A0A286Y0Q2 A0A287D5Z0 A0A2I2ZYC9 A0A2I3TWZ5 A0A2K5CVX8 A0A2K5KAQ1 A0A2K5KTY8 A0A2K5RZN7 A0A2K5Y427 A0A2K6E3B3 A0A2K6GUM4 A0A2K6N5V9 A0A2K6RLZ4 A0A2K6S5R4 E2R198 F1SF95 F6YTQ2 F7IPE9 G1L0Z5 G1T1B7 G3TGJ4 G3XEW8 G5AQI4 G8F480 H0XC87 H2N7S1 M3YRA2 O43447 Q0P5D0 Q4G0C5 Q6FH36 W5QGW0
ENSCAFP00000003706 ENSLAFP00000013602 ENSSTOP00000000101 ENSPPYP00000001699 ENSMICP00000013647 ENSP00000306614 ENSDORP00000015193 ENSTTRP00000004914 ENSBTAP00000006026 gi|5454154|ref|NP_006338.1| ENSOCUP00000009848 ENSMMUP00000017253 ENSCJAP00000005739 ENSCJAP00000043369 ENSECAP00000007790 ENSCPOP00000007388 ENSAMEP00000000547 NP_001069086.1.59421 NP_001069086.1.76553 NP_001103599.1.92730 NP_001247566.1.72884 NP_001265790.1.62641 NP_006338.1.87134 NP_006338.1.92137 NP_082953.1.92730 XP_001073803.2.4139 XP_001503171.1.31192 XP_002750771.2.60252 XP_002811007.2.23681 XP_003128146.2.46622 XP_003128147.2.46622 XP_003128148.2.46622 XP_003339034.1.37143 XP_003415585.1.64505 XP_003462552.1.53824 XP_003513378.1.69978 XP_003775767.1.23681 XP_003812923.1.60992 XP_003812924.1.60992 XP_003937025.1.74449 XP_003937026.1.74449 XP_004001906.1.66739 XP_004001907.1.66739 XP_004025624.1.27298 XP_004025625.1.27298 XP_004266408.1.21590 XP_004321933.1.83887 XP_004321934.1.83887 XP_004406713.1.74151 XP_004443191.1.5094 XP_004591573.1.84141 XP_004614258.1.94378 XP_004645997.1.9945 XP_004678926.1.23501 XP_004740686.1.14098 XP_004871879.1.39548 XP_005083908.1.91757 XP_005204783.2.76553 XP_005270419.1.92137 XP_005317945.1.77405 XP_005410655.1.28644 XP_005543779.1.63531 XP_005543780.1.63531 XP_005543781.1.63531 XP_005543782.1.63531 XP_005678658.1.57651 XP_005678659.1.57651 XP_005678660.1.57651 XP_005866122.1.60319 XP_005901434.1.15283 XP_005901435.1.15283 XP_005965921.1.78601 XP_005965922.1.78601 XP_005965923.1.78601 XP_006068386.1.26621 XP_006068387.1.26621 XP_006153778.1.99106 XP_006153779.1.99106 XP_006174588.1.101512 XP_006215895.1.17985 XP_006225561.1.4139 XP_006225562.1.4139 XP_006762645.1.95426 XP_006762646.1.95426 XP_006762647.1.95426 XP_006839706.1.41390 XP_006886593.1.29581 XP_006904059.1.64745 XP_006904060.1.64745 XP_006934708.1.62641 XP_006995000.1.50099 XP_007077421.1.5354 XP_007110108.1.24612 XP_007110109.1.24612 XP_007110110.1.24612 XP_007164711.1.59432 XP_007164712.1.59432 XP_007164713.1.59432 XP_007164714.1.59432 XP_007164715.1.59432 XP_007453074.1.90284 XP_007453075.1.90284 XP_007526164.1.11023 XP_007617334.1.28591 XP_007617335.1.28591 XP_007651816.1.69978 XP_007953748.1.48129 XP_007977341.1.81039 XP_007977342.1.81039 XP_007977343.1.81039 XP_007977344.1.81039 XP_008070795.1.4292 XP_008070797.1.4292 XP_008149502.1.99482 XP_008263671.1.1745 XP_008263672.1.1745 XP_008263673.1.1745 XP_008263674.1.1745 XP_008263675.1.1745 XP_008527956.1.77740 XP_008571377.1.73410 XP_008571378.1.73410 XP_008697569.1.72690 XP_008841051.1.79516 XP_009249821.1.23681 XP_009249824.1.23681 XP_010345799.1.74449 XP_010345800.1.74449 XP_010370139.1.97406 XP_010370140.1.97406 XP_010632277.1.5607 XP_010801917.2.76553 XP_010860957.1.44457 XP_010860958.1.44457 XP_010958066.1.22495 XP_010958067.1.22495 XP_010993139.1.51371 XP_010993140.1.51371 XP_011233264.1.58354 XP_011376227.1.92234 XP_011376228.1.92234 XP_011762043.1.29376 XP_011762044.1.29376 XP_011762045.1.29376 XP_011762046.1.29376 XP_011762047.1.29376 XP_011762048.1.29376 XP_011800398.1.43180 XP_011800408.1.43180 XP_011800418.1.43180 XP_011800426.1.43180 XP_011857126.1.47321 XP_011857127.1.47321 XP_011857128.1.47321 XP_011857130.1.47321 XP_011934581.1.92194 XP_011934583.1.92194 XP_011934584.1.92194 XP_011934585.1.92194 XP_011934586.1.92194 XP_011967828.1.66739 XP_011996809.1.54773 XP_011996810.1.54773 XP_011996811.1.54773 XP_012290299.1.9421 XP_012290300.1.9421 XP_012290301.1.9421 XP_012387307.1.21590 XP_012387308.1.21590 XP_012387309.1.21590 XP_012502171.1.63892 XP_012502172.1.63892 XP_012577454.1.23501 XP_012666324.1.62490 XP_012784269.1.84141 XP_012784270.1.84141 XP_012872196.1.60039 XP_012978909.1.91757 XP_014335479.1.15283 XP_014422184.1.101512 XP_014722789.1.49734 XP_014922265.1.86478 XP_014922266.1.86478 XP_014991695.1.72884 XP_014991704.1.72884 XP_014991710.1.72884 XP_015104676.1.17985 XP_015292941.1.63531 XP_015340654.1.40921 XP_015843995.1.50099 XP_015995470.1.101085 XP_015995471.1.101085 XP_016060652.1.3490 XP_016060653.1.3490 XP_016060654.1.3490 XP_016060655.1.3490 XP_016060656.1.3490 XP_016855546.1.92137 XP_017728705.1.44346 XP_017728706.1.44346 XP_017728707.1.44346 XP_017728708.1.44346 XP_017898157.1.57651 XP_018872257.1.27298 XP_019284765.1.44245 XP_019284767.1.44245 XP_019499444.1.44202 XP_019499445.1.44202 XP_019499446.1.44202 XP_019606728.1.88060 XP_019663652.1.58354 XP_019691501.1.62641 XP_019793553.1.83887 XP_019813257.1.53367 XP_019813258.1.53367 XP_020026612.1.5219 XP_020026613.1.5219 XP_020026614.1.5219 XP_020770404.1.74333 XP_021490719.1.76796 XP_021490720.1.76796 XP_021490721.1.76796 XP_524688.2.37143 XP_848237.1.84170 ENSOARP00000021959 ENSOGAP00000013377 ENSOGAP00000013377 HGL_H00000306614 ENSPTRP00000001057 ENSDORP00000015193 ENSMPUP00000013861 cath|current|1mzwA00/5-177 cath|current|1qoiA00/5-177 ENSGGOP00000026051 ENSCAFP00000003706 ENSTTRP00000004914 ENSAMEP00000000547 ENSCPOP00000007388 ENSP00000306614 ENSMUSP00000051221 ENSMUSP00000101925 ENSMUSP00000101928 ENSOCUP00000009848 ENSP00000306614 1mzw_A 1qoi_A 5o9z_M ENSBTAP00000006026 ENSCJAP00000005739 ENSMPUP00000013861 1qoiA ENSPANP00000003374 ENSPPYP00000001699 ENSPTRP00000001057 ENSSTOP00000000101 ENSFCAP00000011308 ENSMMUP00000017253 ENSECAP00000007790 ENSFCAP00000024278 10141.ENSCPOP00000007388 9544.ENSMMUP00000017253 9598.ENSPTRP00000001057 9600.ENSPPYP00000001699 9606.ENSP00000306614 9615.ENSCAFP00000003706 9685.ENSFCAP00000011308 9796.ENSECAP00000007790 9986.ENSOCUP00000009848 ENSGGOP00000026051 ENSMICP00000013647 ENSLAFP00000013602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]