SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013895 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013895
Domain Number 1 Region: 1177-1399
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-62
Family DBL homology domain (DH-domain) 0.0000000251
Further Details:      
 
Domain Number 2 Region: 1398-1540
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-31
Family Pleckstrin-homology domain (PH domain) 0.00000148
Further Details:      
 
Domain Number 3 Region: 1091-1175
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-27
Family SH3-domain 0.00000394
Further Details:      
 
Domain Number 4 Region: 232-334
Classification Level Classification E-value
Superfamily EF-hand 2.34e-27
Family Eps15 homology domain (EH domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 1554-1674
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.08e-26
Family PLC-like (P variant) 0.004
Further Details:      
 
Domain Number 6 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 6.92e-26
Family Eps15 homology domain (EH domain) 0.0019
Further Details:      
 
Domain Number 7 Region: 744-815
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-19
Family SH3-domain 0.0000317
Further Details:      
 
Domain Number 8 Region: 856-945
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-19
Family SH3-domain 0.0000161
Further Details:      
 
Domain Number 9 Region: 969-1029
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-19
Family SH3-domain 0.0000414
Further Details:      
 
Domain Number 10 Region: 1035-1107
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-16
Family SH3-domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013895   Gene: ENSMPUG00000014000   Transcript: ENSMPUT00000014115
Sequence length 1684
Comment pep:known scaffold:MusPutFur1.0:GL896914.1:18205414:18345256:-1 gene:ENSMPUG00000014000 transcript:ENSMPUT00000014115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMG
SMPNLSIPHSLPPVAPMATPLSSATSGTTLPPLMMPAPLVPSVSTSSLPNGTAGLIQPLS
IPYSSSTLPHTSSYSLMMGGLGGGASLQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEW
AVPQPSRLKYRQKFNSLDKSMSGYLSGFQARNALLQSNLSQTQLATIWTLADIDGDGQLR
AEEFILAMHLTDMAKAGQPLPLTLPPELVPPSFRGGKQIDSINGTLPSYQKIQEEEPQKK
LPVTFEDKRKANYERGNVELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKK
QLELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNQRNREQ
EEIVRLNSKKKSLHLELEALNGKHQQISGRLQDVRLRKQTQKTEIEVLDKQCDLEIMEIK
QLQQELQDYQNKLIYLVPEKQLLNERIKNMQLGNTPDLGIDLLHKKSLEKEELCQRLKEQ
LDALEKETASKLSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRESYNTQQ
LALEQLHKIKRDKLKEIERKRSELIQKKKLEDEAIRKAKQGKETLWRESLRKEEEEKQKR
LQEEKTQEKVQEEERKVEEKQCEPASALVNYKALYRFEARSHDEMSFNSGDIIQVDEKTI
GEPGWLYGSFQGNFGWFPCNYVEKMPSGEKSVSPKKALLAPTVSVSATSTSSESLSSNQP
ASVTDYQNVSFTNLTVNTSWQKKSAFTRTVSPGSVSPIHGQGQVVENLKAQALCSWTAKK
DNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVKREESEALYAAINK
KPTSAAYTVGDEYIALYSYSSVEPGDLTFIEGEEILVTQKDGEWWTGSIGDRTGIFPSNY
VKPKDQESFGSASKSGTSNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNSSGWWQG
ELQARGKKRQKGWFPASHVKLLGPSSERTTPAFHPVCQVIAMYDYVANNEDELNFSKGQL
INVLNKDDPDWWQGEINGVTGLFPSNYVKMTTDSDPSQQWCADLQSLDTMQPGERKRQGY
IHELIRTEERYVDDLQLVVEVFQKRMVESGFLTEGEMALIFVNWKELIMCNTKLLKALRV
RKKTGGEKMPVQTIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTEFKEFLKKLA
SDPRCKGMPLSSFLLKPMQRITRYPLLIRSILENTLENHVDHSSLKLALERAEELCSQVN
EGVREKENSDRLEWIQAHVQCDGLAEQLIFNSLTNCLGPRKLLHSGKLYKTKSNKELHGF
LFNDFLLLTYMVKQFAVSSGSEKLFSSKSNAQFKMYKTPIFLNEVLVKLPTDPSSDEPVF
HISHIDRVYTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGIGRLMV
QVIEATELKACKPNGKSNPYCEISMGSQSYTTRTLPDTLNPKWNFNCQFFIKDLYQDVLC
LTMFDRDQFSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTGEVWVRFDLQLFEQ
KTLL
Download sequence
Identical sequences M3YRD6
XP_004745974.1.14098 ENSMPUP00000013895 ENSMPUP00000013895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]